KEGG   Ailuropoda melanoleuca (giant panda): 100472595Help
Entry
100472595         CDS       T01329                                 

Definition
histone-lysine N-methyltransferase SUV39H1-like
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aml00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 410 aa AA seqDB search
MAENLKGCNVCCKSSWNQLQDLCRLAKLSCPALGVSKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLXPKKRVRIECKCGTESCRKYLF
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggatgcaatgtgtgttgcaagtcttcttggaatcagctacag
gacctgtgccgcctggccaagctctcctgccctgccctcggcgtctccaagaggaatctt
tatgactttgaagtcgagtacctgtgtgattacaagaaaatccgcgaacaagagtattac
ctggtaaaatggcgtgggtacccagactcagagagcacctgggagccacggcagaatctc
aagtgcgtgcgcattctcaagcagttccacaaggacttagaaagggagctgctccgccgg
caccaccggtcaaagcccccccggcacctggacccaagcttggccaactacctggtacag
aaggccaagcagaggcgggcgctccggcgctgggagcaggagctcaatgccaagcgcagc
cacctgggacgcatcaccgtggagaacgaggtggacctggacggccccccgcgggctttc
gtatacatcaacgagtaccgtgtgggtgagggcatcaccctcaaccaggtggcggtgggc
tgtgagtgccaggactgtctgtgggcccccgctggaggctgctgccccggggcatccctg
cacaagtttgcctacaatgaccagggtcaggtgcggctgcgcgccgggctgcccatctac
gagtgcaactcccgctgccgctgcggctatgactgccccaaccgtgtggtacagaagggc
atccgctatgacctctgcatcttccgcacggatgacgggcgtggctggggcgtccgcacg
ctggagaagatccgcaagaacagcttcgtcatggagtacgtgggagagatcattacctca
gaggaggcggagcggcggggccagatctacgaccgccagggcgccacctacctcttcgac
ctggactacgtggaggacgtgtacaccgtggatgccgcctattacggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcgactgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggccgggctcncccccaagaagcgggtccgtattgaatgcaagtgt
gggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system