KEGG   Ailuropoda melanoleuca (giant panda): 100472595Help
Entry
100472595         CDS       T01329                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1 (Drosophila)
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100472595 (SUV39H1)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100472595 (SUV39H1)
Chromosome [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100472595 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100472595 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 410 aa AA seqDB search
MAENLKGCNVCCKSSWNQLQDLCRLAKLSCPALGVSKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLXPKKRVRIECKCGTESCRKYLF
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggatgcaatgtgtgttgcaagtcttcttggaatcagctacag
gacctgtgccgcctggccaagctctcctgccctgccctcggcgtctccaagaggaatctt
tatgactttgaagtcgagtacctgtgtgattacaagaaaatccgcgaacaagagtattac
ctggtaaaatggcgtgggtacccagactcagagagcacctgggagccacggcagaatctc
aagtgcgtgcgcattctcaagcagttccacaaggacttagaaagggagctgctccgccgg
caccaccggtcaaagcccccccggcacctggacccaagcttggccaactacctggtacag
aaggccaagcagaggcgggcgctccggcgctgggagcaggagctcaatgccaagcgcagc
cacctgggacgcatcaccgtggagaacgaggtggacctggacggccccccgcgggctttc
gtatacatcaacgagtaccgtgtgggtgagggcatcaccctcaaccaggtggcggtgggc
tgtgagtgccaggactgtctgtgggcccccgctggaggctgctgccccggggcatccctg
cacaagtttgcctacaatgaccagggtcaggtgcggctgcgcgccgggctgcccatctac
gagtgcaactcccgctgccgctgcggctatgactgccccaaccgtgtggtacagaagggc
atccgctatgacctctgcatcttccgcacggatgacgggcgtggctggggcgtccgcacg
ctggagaagatccgcaagaacagcttcgtcatggagtacgtgggagagatcattacctca
gaggaggcggagcggcggggccagatctacgaccgccagggcgccacctacctcttcgac
ctggactacgtggaggacgtgtacaccgtggatgccgcctattacggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcgactgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggccgggctcncccccaagaagcgggtccgtattgaatgcaagtgt
gggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system