KEGG   Ailuropoda melanoleuca (giant panda): 100472605Help
Entry
100472605         CDS       T01329                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100472605
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100472605
Transfer RNA biogenesis [BR:aml03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100472605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 308 aa AA seqDB search
MASNPTVLMRLVASAYSIAQKAGTIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICS
SLARKFPKLTIIGEEDLPFEEVDQELIEDGQWEEILQQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQAGPDAVLGRTIWGVLGLGAFGF
QLKEVPAGKHIITTTRSHNNKLVTDCVTAMNPDDVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLATLRNYDYYASRVPE
SVKNALVP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaatcccaccgtgttgatgcggctggtagcctcagcatattctatcgctcag
aaggcaggaaccatagtcagacgtgttattgctgaaggagacctgggtatcgtggagaag
acctgtgcaacagacctgcagaccaaagctgaccgattggcacaaatgagcatatgctct
tcactggcacggaaattccccaaactgacaatcataggggaagaggatctgccttttgaa
gaagtggaccaagagctcattgaagatggtcaatgggaggagatactgcagcagccgtgc
ccatcccagtacagcgctattaaagaagaagatcttgtggtctgggttgatcctctggat
ggtaccaaggaatacactgaaggtcttcttgacaacgtgacagtccttattggaattgct
tatgaaggaaaagccatagcaggagttattaaccagccatattacaattaccaggcagga
cccgatgctgtgttggggaggacaatctggggagttttaggtttaggtgcctttgggttt
cagctgaaagaggtgcctgctgggaaacacatcatcacaacgacccgctcccataacaac
aagttggtgactgactgtgtcaccgccatgaaccctgatgacgtgctgcgagtgggagga
gcaggaaataagataattcagctgattgaaggcaaagcctctgcatatgtatttgcgagt
cctggatgtaagaagtgggatacttgtgctccggaagtcattttacatgctgtgggaggc
aagttaaccgatatccatggaaatgcccttcagtataacaaggaggtgaagcacatgaac
tccgcaggcgtcctcgccacgttgcgcaattacgactactatgcaagtcgagttccagag
tctgtgaaaaatgcacttgttccttaa

DBGET integrated database retrieval system