KEGG   Ailuropoda melanoleuca (giant panda): 100472619Help
Entry
100472619         CDS       T01329                                 

Definition
histone-lysine N-methyltransferase EZH1-like
Orthology
K17451  
histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 747 aa AA seqDB search
MDMPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQLMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHTLEGNKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGR
RRRRHHMVGASCSNTSASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPP
QLCVVEAPLEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILK
LPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMT
QNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVV
SCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYD
KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAG
EELFFDYRYSQADALKYVGIERETDVL
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggatatgccaaatcccccaacttccaaatgcatcacttactggaaaagaaaagtcaaa
tctgaatacatgcgactccggcaactgaaacggcttcaagcaaatatgggtgccaaggct
ctctatgtagcaaattttgcaaaggttcaagaaaaaacccagatcctcaatgaagaatgg
aagaagcttcgtgtccaacctgtgcagttgatgaagcccgtgagtgggcacccttttctc
aaaaagtgtaccatagagagcattttcccaggatttgcaagtcaacatatgttaatgagg
tctctgaacacagttgctttggttcccatcatgtattcctggtcccctctccagcagaac
tttatggtagaagacgagacagttttgtgcaatattccctacatgggagatgaggtgaaa
gaagaagatgagactttcattgaggagctgatcaataactatgatgggaaagtccatggc
gaagaagagatgatccctggatctgtcctgattagtgacgcagttttcctggagttggta
gatgctctgaatcaatactcagatgaggaggaggaagggcacaatgacacctcggatgga
aagcaagatgacagtaaagaagatctgccagtaacaagaaagagaaaaagacacactctt
gaaggcaacaaaaagagttccaagaaacagttcccaaatgacatgatcttcagtgcaatt
gcctcgatgttccctgagaatggtgttccagatgacatgaaggagaggtatcgagagcta
acagagatgtcagatcccaatgcacttccccctcagtgcacacccaacatcgacggcccc
aatgccaagtccgtgcagcgggagcagtctctgcactccttccacacactgttttgtcga
cgctgcttcaaatacgactgcttccttcacccttttcacgccacccctaatgtatataaa
cgcaagaacaaagagatcaagattgaaccagaaccatgtggcacagactgcttccttttg
ctggaaggagcgaaggagtacgccatgcttcacaaccctcgctccaagtgctctggtcgt
cgccggcgaaggcaccacatggtcggtgcttcctgctccaacacttcagcctctgctgtg
gctgagactaaagaaggggacagtgacagggatacaggcaatgactgggcctccagttct
tcagaggccaactctcgctgtcagacccccacgaagcagaaggctagtccggccccacct
cagctctgtgtagtggaggcacccctggagcctgtggaatggactggggctgaggaatcc
ctttttcgagtctttcatggcacctacttcaacaacttctgttcaatagccagacttcta
ggcacaaagacgtgcaagcaggtctttcagtttgcagtcaaagaatcacttatcctgaag
ctgccaacagatgagctcatgaacccatcgcagaagaagaaaagaaagcacagattgtgg
gctgcccactgcaggaaaattcagctgaagaaagataactcttccacacaagtgtacaac
taccagccctgcgaccatccagaccgcccctgtgacagcacctgcccttgcatcatgacg
cagaatttctgtgagaagttctgccagtgcaacccagactgtcagaatcgttttcctggc
tgtcgctgtaagacccagtgcaacaccaagcagtgtccctgctacctggcagtgcgagag
tgcgaccccgacctgtgcctcacctgcggggcctcagagcactgggactgcaaggtggtt
tcctgcaaaaactgcagcatccagcgaggcctcaagaagcacctgctgctggccccctca
gatgtggccggatggggcaccttcattaaggagtctgtgcaaaagaacgaattcatttct
gaatactgtggcgagcttatctctcaggatgaggctgatcggcgggggaaggtctatgac
aaatacatgtccagcttcctcttcaacctcaacaatgatttcgtagtagatgctacccgg
aaaggaaacaaaattcgatttgcgaaccattcggtgaaccccaactgttatgccaaagtg
gtcatggtgaatggggatcatcgcattgggatctttgctaaaagggcgattcaagctggt
gaagagctcttctttgattacaggtacagccaagctgatgccctcaagtacgtggggatc
gagagggagaccgatgtcctttag

DBGET integrated database retrieval system