KEGG   Ailuropoda melanoleuca (giant panda): 100472627Help
Entry
100472627         CDS       T01329                                 

Definition
gem-associated protein 7-like
Orthology
K13135  
gem associated protein 7
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100472627
Spliceosome [BR:aml03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    100472627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 131 aa AA seqDB search
MQTPVTIPVPVLRLPRGPDGLSRGFAPDGRRAPLTPEGPETPGSAVVQESRGSQEQQARA
ALRERYLRSLLAMVGHQVSFTLHEGVHVTARFGATDLDVANFYVSQLQTPIGVQAEALLR
CSDIIAYTFKP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcagactccagtgaccattcctgtgcctgtgctccggctcccccggggcccagatggc
ttgagccgaggctttgccccagatggacgcagggcccccctgacgccagagggtcccgaa
accccagggtctgcagtagttcaagaatcccggggatcccaggaacagcaggcacgagct
gcactccgggagcgctacctccgcagcctgctggccatggtgggtcaccaggtgagcttc
acattgcacgagggtgtgcacgtgactgcccgcttcggagccaccgacctggacgtggcc
aacttctacgtgtcgcagctgcagacgcccataggtgtgcaggctgaggcgctgctgcgg
tgtagtgacattattgcatacaccttcaagccataa

DBGET integrated database retrieval system