KEGG   Ailuropoda melanoleuca (giant panda): 100472705Help
Entry
100472705         CDS       T01329                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100472705 (NUP205)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100472705 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2012 aa AA seqDB search
MATLLAVNSAASLWGPYKDIWQTVGNALWRRQPEAVHLLDMILKKHKPDFISLFRNPPKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELVSMTTRFTEELMEQ
GLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKDDTLLLIGHLEKVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMMHQLPL
LTERQYIATIHSRLQDSQLWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMA
ELAIADNVFLFLTESVVVSENFYQEEFYIRRIHNLITDFLALMPMKVKQLRNRADEDARI
IHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNTFNLELALEYWCPSEPLQTSTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSS
HVENIQGTGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAF
LQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAAFGKSPEIA
ASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFCHLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAELVLEVFYKLLRDYEPQL
EDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLEQLLQGINPRTKKADNVVNIA
RYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSVSQKLMAGFVECLDSEDT
EEFVRLEEGSELEKKLAGIRHETRIHILNLLITSLERNPPNLALYLLGFELKKPVSTTNL
QDPGVLGCPRTCLHAILNILEKGTKGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQHLPFSNKEYEMSMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHRNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TILQYVVGRNKLLQCLHAKRHVLESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHD
KILDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQKQPLVSGPGETHYAFMLDSSFTSPPP
AENPGGGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALL
DRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDHTLQSLLTPQPPLLKALYTYESKMAFL
TRVAKIQQGALELLRSGVIVRLAQCQVYDMRPEMDPQGMFGMRDPPVFIPAPVDRYRQIL
LPALRLCQVILTSSTAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGILNELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEG
DRVSKKDELELAMQQICANVMEYCQSLMLQSSPTFQYAVCLFTPSLSETINRDGSRQDTQ
APVIPYWRLPGLGIIVYLLKQSANDFFSYYDSHRRSVNKLQNVEQLPPDEIKELCQSVMP
VGVEKISTAQKYVLARRRLVKLINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCTPMDS
QDSLFASRTLFKSRRLQDSFTSETNLDFRSGLTGVSQHDIDQLQADAINSFGESLQKKLL
DIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6039 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgctgttggcggtaaattcggctgccagtctctggggtccttacaaagacatt
tggcaaacagtgggaaatgctctttggagaagacaacctgaagctgtccaccttcttgac
atgattttgaagaaacacaaacctgacttcatctcactgttcagaaacccaccaaaaaat
gtccaacaacatgagaaggttcagaaagccagtactgagggagttgctatccagggtcaa
cagggaacccgacttcttcctgaacagctcattaaagaggcctttatccttagtgacctt
tttgatattggagaattggcagctgttgagcttctccttgccggagagcaccaacagcca
cattttcctggtctcaccagaggattagtagctgttcttttatactgggatggaaaacgg
tgcattgcaaactctctgaaagccttgatacagtctagacgaggaaaaacatggaccctt
gaactcagtccagagctggtttccatgacaacacgctttacagaggagctgatggagcaa
ggattgacttataaagtccttactctggtgtcacagattgatgtgaacaatgagtttgag
aaactacagcgggagagaggtttgggcagtgaaaaacaccgaaaagaggtttctgatctc
atcaaggagtgcaggcagtctctggcagaaagcctttttgcctgggcttgtcagtcacct
ttaggcaaagatgacactctgcttcttattggacatttggaaaaagtgacagttgaggct
aacggctcattggatgcagtgaatctggctcttcttatggcgcttctgtactgctttgat
atcagtttcatagaacaaagcacagaggaacgagatgatatgatgcatcaacttccactg
ctgacagaaagacaatacatcgcaacaattcactcccgccttcaagactcacagctttgg
aaactgcctgggctccaagccactgttagacttgcctgggcactggcattgagaggaata
tctcagctacctgatgtgacagctctggctgaattcacagaagcagatgaagcaatggca
gaacttgcgattgctgacaatgttttcctcttcctcactgaatccgtagtggtgtcagaa
aacttctatcaggaggaattttatatccgtagaatccataatctcatcacagatttcctt
gcccttatgccaatgaaggtgaaacagttgagaaatcgggcagatgaagatgctcgaatc
attcatatgagtatgcagatgggtaatgaacctcccatttcacttagaagagatctggag
cacttaatgctcttgattggtgagctatataaaaagaacacttttaatttggagcttgct
ctcgaatattggtgtccctcagagcctcttcagacttccactatcatgggttcttacctt
ggggtggctcatcagcgaccccctcaacgccaggttgtcttgtcaaagtttgttaggcaa
atgggtgacctactgcctccaacgatttacattccttatttgaaaatgctccagggattg
gccaatgggccccagtgtgcccactactgtttcagcctgcttaaagtcaatggtagtagt
catgttgaaaatattcagggaacaggtggcagtcctgtttcctgggaacatttctttcac
tccttaatgctttaccacgagcacctccggaaggatcttccaagtgcagatagtgtccag
taccgtcaccttccttcacgtggcatcacccagaaggagcaggatggattgattgctttt
ttacagctcacctccaccatcattacctggagtgaaaatgctcgtctggcactctgtgaa
catcctcagtggaccccggttgtggtgattctgggactcctgcaatgcagtattccccct
gttctcaaagcagagctgctgaagacccttgcagctttcggaaaatcccctgaaattgct
gcttccctctggcagtcgttggaatacactcagatactacagaccgtaagggttccaagc
cagaggcaagctatcggtatcgaggttgaactaaatgaaatagaatcccggtgtgaagaa
tacccgttgactcgcgctttttgccatcttattagtaccttggtggagagctcatttcct
tctaatttgggtgctggcctgcggccccctggctttgacccttatttgcagttccttaga
gattctgtgtttctccgattccgcacaagagcttaccggagagcagctgaaaagtgggaa
gttgctgagcttgttttggaggtgttttataaattgctcagagattatgagcctcaactt
gaagattttgtagaccagtttgtggaattacaaggagaagaaatcatagcgtacaagcca
ccaggatttagtctgatgtatcatcttctgaatgagtcaccaatgttggagcttgccctt
agtttactggaagaaggcgttaagcagctggatacctatgcccctttccctgggaagaaa
cacttggagaaagcagtacagcattgccttgcacttctcaatctgactctgcaaaaggaa
aatctctttatggatcttctaagagagagtcagctggctctaatagtctctcctttagaa
cagctgttacagggaatcaatcccagaactaagaaggctgataatgtggtgaatattgcc
agatacctgtatcatggcaatactaacccggaattggcttttgaaagcgccaagatcctc
tgctgtatctcgtgtaattccaatattcagataaaactggttggagatttcacacatgac
cagagtgtaagtcagaagctgatggctggatttgtggagtgtttggatagtgaagataca
gaagaatttgtccgtctagaagagggatcagaacttgaaaagaagttagctggaatccgt
catgaaacaagaatccacatcttgaatcttctcatcacctctctggaacgcaacccaccc
aaccttgctctctacctcctgggctttgaactgaagaaacccgttagtaccacaaacctg
caagatccaggagtgttaggttgccctcgaacatgccttcatgccattttaaacatcttg
gagaaaggaaccaaagggagaacaggcccggtggcagtgagagaatctcctcaactcgct
gaactatgttaccaggtgatttatcagttgtgtgcatgctctgacacatccggtcctacg
atgaggtacttgagaaccagccaggatttcttattttctcagttgcaacatttacctttt
tctaacaaagagtatgaaatgtctatgctgaaccagatgtcatggctaatgaagactgcc
tcaatagaactaagggtaacttctctgaatcgtcaacggtcacatacccagaggctccta
cacctcttactggatgacatgcccgtgaaaccgtactcagatggtgaaggaggaatagaa
gatgaaaataggtctgtctctgggttccttcactttgacactgctacaaaagtacgtcga
aaaattctaagtattcttgactcaattgacttcagtcaggagatccctgaacctttgcag
ttggacttctttgatcgggcccagattgaacaagttattgctaactgtgagcacaggaat
ttacggggacagacagtctgcaacgtcaagcttcttcatagggttcttgtagctgaagta
aatgcccttcagggtatggcagccataggacagagacctctactgatggaggaaatcagc
actattcttcagtatgtggtaggaagaaacaaattgctgcagtgtcttcatgcaaaacgg
catgtattagagtcgtggaggcagctggtagaaattatactgacagcttgtccccaggac
ctcattcaggcagaggaccgacaactgattattcgtgatattttacaagatgtgcatgat
aagatactggatgatgaagcagcacaggagttaatgccggtggtagcaggtgctgtgttc
accctgactgctcacctgagccaagccgttcgcacagaacagaagcaaccattagtctcg
ggacccggagagacccattatgcttttatgcttgatagttctttcacctccccgcctcca
gcagagaacccaggggggggttttgcttctattggggattcttcgcttcacatcatattg
aagaagctcttggacttcattttgaagacaggtggcggattccagcgagtgaggacacac
ctgtatggctctctgttgtattacttacagatcgcccagagaccagatgaaccagacaca
ttagaagcagccaagaaaactatgtgggaaaggctgacagcccctgaagatgtttttagt
aaattacagcgagaaaacatagccatcattgagagctacggcgctgcgctcatggaagtg
gtctgtcgagatgcctgtgatggtcatgagattggaaggatgctggcactggctctactt
gatcggattgtctccgtagataaacagcagcagtggcttttgtatctttctaacagtggc
tatttgaaggtgcttgtggacagcttggtagaagatgaccatactttgcagagcttacta
actccacaacctccccttctaaaagccctttatacttacgaatccaaaatggcatttctt
acaagagtggctaaaatacagcagggtgcgttagaactgctgaggtctggggtgatagtg
agactggcacaatgccaggtctatgacatgcgcccagagatggacccacagggcatgttc
ggcatgagggacccgccagtgttcatcccggccccggtggaccgctaccggcagatcctg
ctcccggctctccgcttgtgccaggtcatcctcacgtccagcacggcccagcacttacag
gcagcggggcaggtgttgcagtttctcatttcacattctgataccatacaagcaatcttg
cgctgtcaggatgtgagtgctgggtctttgcaggaactggctctgctgacaggaattatc
agtaaagcagcacttcctggtatactaaatgaacttgatgttgatgtaaatgaaggatca
ctaatggagctacagggacatatcggaagattccagcgccagtgtttaggactactaagc
cgctttgggggctctgacagactgcgtcagtttaaatttcaagatgataatgtggaagga
gatagagtgagcaagaaagatgagctcgaactggccatgcagcagatctgtgccaatgtc
atggaatattgccagtcactcatgttacagagctcccccacatttcagtatgctgtgtgt
ctcttcacccctagcctgtcagaaaccattaatagagatggatcccggcaagatactcaa
gctccagtgattccatattggcgcctgcctggtttgggcattattgtctacctgctgaaa
cagagtgctaatgatttcttcagctattatgacagccatcgacggagtgtcaacaagcta
cagaatgtagagcaacttccaccagacgagatcaaagagttgtgtcagtctgtgatgccc
gttggtgttgagaaaatctccactgcccagaaatatgttctagcaagacggcgtttggtg
aagttgatcaacaatcgagccaaactgctttccctttgttcttttatcatagagacctgc
ctatttattctttggcgccatctggagtactacttgttacactgcacgcccatggattct
caagattccttgtttgcctccagaaccttgtttaaaagcagaagactacaagattccttc
acttcagaaaccaacctggattttagaagtggactgactggagtgagccaacatgacata
gaccagcttcaggctgacgccatcaattcttttggagaatcactacaaaagaaacttctg
gacattgaaggattatactcaaaagttcgatctcgctatagtttcatacaagctcttgtc
agacgtatccgaggcctgctgaggatatccaggaactga

DBGET integrated database retrieval system