KEGG   Ailuropoda melanoleuca (giant panda): 100472774Help
Entry
100472774         CDS       T01329                                 

Definition
(RefSeq) cytochrome P450 1A2
  KO
K07409  cytochrome P450 family 1 subfamily A polypeptide 2 [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00140  Steroid hormone biosynthesis
aml00232  Caffeine metabolism
aml00380  Tryptophan metabolism
aml00591  Linoleic acid metabolism
aml00830  Retinol metabolism
aml00980  Metabolism of xenobiotics by cytochrome P450
aml00982  Drug metabolism - cytochrome P450
aml01100  Metabolic pathways
aml05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100472774
   00591 Linoleic acid metabolism
    100472774
  Amino acid metabolism
   00380 Tryptophan metabolism
    100472774
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100472774
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100472774
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100472774
   00982 Drug metabolism - cytochrome P450
    100472774
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100472774
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100472774
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP1 family
   100472774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100472774
NCBI-ProteinID: XP_011227900
Ensembl: ENSAMEG00000008842
Position
Un
AA seq 512 aa AA seqDB search
MASSQMATELLLASAVFCLVLWVVRAWQPRVPKGLKSPPGPWGWPLLGNVLTLGKSPHLA
LSRLSQRYGDVLQIRIGSTPVLVLSGLDTIRQALVQRGDDFKGRPDLYSFTLVTDGQSMT
FNPDSGPVWAARRRLAQNALKSFSTASDPASASSCYLEEHVSKEAEALLSRLQERMAEVG
HFNPYNQVLLSVANVIGAMCFGQHFPQSSEEMLTLVKHSNDFVEIASSGNPVDFFPILQY
MPSPALQRFKAFNQKLVRFLQKIVQEHYRDFDEGSVQDITGALLKHSEKGSRASGGHIPH
EKIVNLINDIFGAGFDTVTTALSWSLMYLVTNPEIQRKIQKELDTVIGRVRRPQLSDRPQ
LPYMEAFILEIFRHTSFVPFTIPHSTTRDTTLKGFYIPKERCVFINQWQVNHDQKVWGDP
SEFRPERFLTVDGTAINKTLSEKMMIFGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVP
AGVKVDLTPIFGLTMKHTHCEHVQARPRFSTK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtcccagatggccactgagctcctcctggcctcggccgtcttctgcctggtg
ctctgggtggtcagggcctggcagcctcgggttcccaaaggcctgaagagtcccccgggg
ccctggggctggcccctgctggggaacgtgctgaccttggggaagagcccgcatctggcg
ctgtcgaggctgagccagcgttatggggacgtgctgcaaatccgcatcggctcgacgccc
gtgctggtactcagcggcctggacaccatccggcaggccctggtgcaacggggtgatgat
ttcaagggccggcccgacctttacagcttcactctggtcacagatggccaaagcatgacc
ttcaacccagactctggaccagtgtgggctgcccgcaggcgcctggcccagaatgccctg
aagagtttctccacggcctcagacccggcatccgcgtcctcctgctacctggaagagcac
gtgagcaaggaggccgaggccctcctcagcaggctgcaggagcggatggcagaggttggg
cactttaacccctacaaccaagtgctgctctcggtggccaacgtcattggtgccatgtgc
tttgggcagcacttccctcagagcagtgaggaaatgctcacgctcgtaaagcacagcaat
gattttgtggagattgcctcctccgggaaccctgtggacttcttccccatccttcaatat
atgcccagccccgccctgcagagattcaaggccttcaaccagaagttagtgcggttcctg
cagaaaattgtccaagagcactaccgggactttgacgagggcagcgtccaggacatcaca
ggcgccctcttgaagcacagtgagaagggctccagagctagtggtggccacatcccccat
gagaagatcgtcaaccttatcaacgacatttttggggccggatttgacactgtcacaaca
gccctctcctggagcctcatgtaccttgtgacaaaccctgagatacagaggaagatccag
aaggagctggacacagtgattggcagggtccggcggccccagctctccgacagaccccag
ctcccctacatggaggcattcatcctggagatcttccgacacacctcctttgtccccttc
accatcccccacagcacgacaagggacacgacactgaaaggcttctacatccccaaggaa
cgctgtgtcttcataaaccagtggcaggtcaatcatgaccaaaaggtgtggggggatcca
tctgagttccgaccagagcgattcctcactgttgatggtactgcaatcaacaagaccttg
agtgagaagatgatgatctttggcatgggcaagcgccgatgtataggggaggtcctggcc
aagtgggagatcttcctcttcctagccatcttgctgcagcagctggagttcagtgtgcca
gcaggtgtgaaagtagacctaacccccatctttgggctgaccatgaagcacacccactgt
gagcatgtccaggcacggccacgcttctccaccaagtga

DBGET integrated database retrieval system