KEGG   Ailuropoda melanoleuca (giant panda): 100472870Help
Entry
100472870         CDS       T01329                                 

Gene name
CHKA
Definition
(RefSeq) choline kinase alpha
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00564  Glycerophospholipid metabolism
aml01100  Metabolic pathways
aml05231  Choline metabolism in cancer
Module
aml_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
aml_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100472870 (CHKA)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100472870 (CHKA)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100472870 (CHKA)
    2.7.1.82  ethanolamine kinase
     100472870 (CHKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Kdo
Motif
Other DBs
NCBI-GeneID: 100472870
NCBI-ProteinID: XP_011225877
Ensembl: ENSAMEG00000001272
Position
Un
AA seq 411 aa AA seqDB search
MSDNGLCGQREQGPRPPPRAKALPPPPLPPPPTDEQPEPRTRRRAYLWCKEFLPGAWRGL
REDQFHISVIRGGLSNMLFQCSLPDTVATVGDEPRKVLLRLYGAILKMRSCNKEGSEQAQ
KENEFQGAEAMVLESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISA
EIAEKMATFHGMKMPFNKEPKWLFGTMEKYLNQVLRIKFAGEPRGKQLHRLLRLNLPLEL
EYLRSLLESTPSPVVFCHNDCQEGNILMLEGRENSEKQRLMLIDFEYSSYNYRGFDIGNH
FCEWMYDYNYEKYPFFRANTLKYPTKKQQLHFICNYLAAFHNEFENLSNEEKSIIEEEML
LEVNRFALASHFFWGLWSVVQAKISSIEFGYMDYAQARFDAYFDQKRKLGV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaacggactgtgtggccagcgggagcagggccctcgtccccctccgcgggca
aaggcgctgccgccgccgccgctgccgccgccgccgaccgacgagcagcccgaacctcgg
acgcggcgcagggcctatctgtggtgcaaggagttcctgcccggtgcctggcggggcctt
cgtgaggaccagttccacatcagtgtcatcagaggtggcctcagtaacatgctgttccag
tgctccttacccgacaccgtggccaccgttggtgacgagcctcggaaagtgctcctgcgg
ctctacggggcaattttaaagatgaggtcctgtaataaagagggatccgaacaagctcag
aaagaaaatgaatttcaaggggccgaggccatggttctggagagcgttatgtttgccatt
cttgcagagaggtctcttgggccaaagctgtacggcatctttccccaaggccgcctggag
cagttcatcccgagccggcgcttagacactgaagaattaagtttgccagatatttctgca
gaaatagccgagaaaatggccacatttcatggtatgaaaatgccattcaataaggaacca
aaatggctttttggaacaatggaaaaatacctgaatcaggtgctgcggattaagtttgcc
ggggagccccggggcaagcagctccatcggctcctgcgcctcaacctgcccctggagctg
gagtacctgcggtcgctgcttgaatccaccccttctccagtagtgttttgtcataacgac
tgtcaggaaggtaatatcttgatgctggagggcagagagaattctgaaaagcagagactg
atgctcatcgacttcgaatacagcagttataattacaggggattcgacattgggaatcat
ttctgtgaatggatgtatgactataactacgaaaagtaccctttcttcagagcgaacacc
ctgaaataccccaccaagaaacaacagctccactttatttgcaattacttggctgcattc
cataatgaatttgaaaacctcagtaatgaagaaaagtccattatagaggaagagatgttg
cttgaagtcaataggtttgcccttgcgtcccatttcttctggggactttggtccgttgtg
caggccaagatttcatccatcgaatttggatacatggactatgcccaagcaaggttcgat
gcctatttcgaccagaagaggaagctcggggtgtga

DBGET integrated database retrieval system