KEGG   Ailuropoda melanoleuca (giant panda): 100472906Help
Entry
100472906         CDS       T01329                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100472906
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100472906
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100472906
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100472906
  Exosomal proteins of colorectal cancer cells
   100472906
  Exosomal proteins of bladder cancer cells
   100472906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 505 aa AA seqDB search
MRPRCHALFPGVALLFAAAGVAFASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNKYDDDGEGITLFRPSHLMNKFEDKTVAYIEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGNKLSFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNDENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLRKDPNIIIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPIIQEEKTKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccccgctgccatgcgctgttcccgggcgtggcgctgcttttcgctgcggccggt
gtcgcctttgcctccgacgtgctggaactcactgacgacaacttcgagagtcgcatctcc
gacacgggctctgcgggcctcatgctcgtcgagttcttcgccccttggtgtggacactgc
aagaggcttgcccctgagtatgaagcagcagcaaccagattaaaaggaatagtcccatta
gcaaaggttgattgtactgccaacacgaacacctgtaataagtatggagtcagtggatat
ccaaccttgaagatatttagagatggtgaagaagctggtgcttatgatgggcccaggact
gccgatggaattgtcagccacctgaagaagcaggcaggaccagcttcggttcctctcagg
actgaggaagaatttgagaagttcattagtgacaaagatgcttctgtggtgggttttttc
aaagatttattcagtgaagctcactctgagtttctaaaagcagccagcaacttgagggat
aactaccgatttgcacacaccaatgtggagtctctggtgaacaaatatgatgatgatgga
gaaggtatcaccttgtttcgtccttcacatttaatgaacaagtttgaggacaagactgtg
gcatatatagaacagaaaatgactagtggcaagattaaaaaatttatccaagaaaatatt
tttggaatctgccctcacatgacagaagacaataaagatttgatacagggcaaggactta
cttgtggcttactatgatgttgactatgaaaagaacgctaaaggttctaactactggaga
aacagagtgatgatggtagcaaagaaattcctagatgctggaaacaaactcagctttgct
gtagctagccgcaaaacctttagccacgaactttctgattttggcttggaaagcactgct
ggagagattcctgttgttgctatcagaactgcaaaaggagagaagtttgtcatgcaagag
gagttctcgcgggatggcaaggctcttgaaagattcctgcaggattactttgatggcaac
ctgaagagatacctgaagtctgagcccatcccggagagcaatgatgggccggtaaaggta
gtggtagcagagaattttgatgaaatagtgaatgacgaaaataaagatgtactgattgaa
ttttatgctccttggtgtggtcactgtaagaatctggaacccaagtataaagaactggga
gaaaagctcagaaaagacccaaatattatcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaag
aagctaaatccaaagaaatacgaaggtggccgtgaattaagtgattttattagctatcta
caacgagaggcaacaaatccccctataattcaagaagaaaaaactaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system