KEGG   Ailuropoda melanoleuca (giant panda): 100473097Help
Entry
100473097         CDS       T01329                                 

Gene name
RASGRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Ras signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:aml04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:aml04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1239 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPKAGVGPGGSRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRIMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDSAPFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTTTYSPAASPP
PHTGKVPLDLSRGLPSPEQSPGSVEEPIDNPRMDLCNKLKRSIQRAVLESVPMDRAGVES
SPVADSTDLSPCRSPSTPQHLRYRQPVGQTADNSHCSVSPASAFAIATAAAGHGSPPGFN
NTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLP
QERKATANILRALSQDDQDDIHLKLEDIIQLTDCAKAECFETLSAMELAEQITLLDHVIF
RSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWV
AVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKN
LRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQT
CYRIDHQPKVTQYLLDKALIIDEDTLYELSLKIEPRLPA
NT seq 3720 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggccttcctggcccgc
aaggagggcaccaaacgcggcttcctgagtaagaaggccgccgaggcgagtcgctggcac
gagaagtggttcgctctctaccagaatgtgctcttctacttcgagggcgagcagagcggc
cgcccggcgggcatgtacctcctggagggctgcagctgcgagcggacgcccgcgccgccc
aaggccggagtcgggccgggcggctcccgggatgcgctggacaagcagtattactttacc
gttctttttggccacgaaggtcagaaacctctggagctgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcaccaagccagttatgcagacattttgattgagagg
gaagtgttaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccagctccggcatcaacttgaagatcaagatacagaaatcgaaagacttaaatca
gagattatcgctcttaataaaaccaaggaacgaatgcggccttaccaaagcaaccaagaa
gatgaggatccagacatcaagaagattaaaaaggttcagagcttcatgagaggatggttg
tgtagaaggaaatggaagactattgtgcaggattacatttgttctcctcatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggttgaagccgagtcagagtatgttcac
cagctctacatcctggtcaatggcttcctccggcccctgagaatggcggccagctccaag
aagcctcccatcagccatgatgatgtcagcagcatttttctcaacagcgaaacgatcatg
tttcttcatgaaatatttcaccaaggactgaaagcaaggatagcaaactggcctactcta
attttagctgatttgtttgatattttgctccccatgttgaacatttatcaagaatttgtg
cgtaatcaccagtacagcctccaagtgcttgccaattgtaagcaaaacagagattttgac
aaactcttaaaacagtatgaagccaaccctgcctgtgaggggaggatgctggaaacgttc
ctgacctatccaatgttccagatccccaggtatatcatcacacttcatgaactcctagct
catactccccatgagcatgtggaaaggaaaagtctggagtttgctaaatcgaaactagag
gaactatccaggataatgcatgatgaagtgagtgacactgaaaacataaggaagaacctt
gccatagaaagaatgatcgtagagggctgtgatatcttgctggacaccagccagactttc
atccgccaaggttctcttattcaagtaccttctgttgagagggggaaacttagtaaagtt
cgcctgggttcattgtctttgaaaaaggaaggagaaagacaatgcttcttatttacaaaa
cactttttaatttgtacgagaagctcgggaggaaagctgcatctgctcaagacaggtggg
gttctctctctaatagaatgtacgttgattgaggagcctgatgcaagtgatgatgactcc
aaaggttctgggcaagtgttcggacacctggattttaaaatagtagtggagccccctgat
tctgcccccttcactgtagtcttgttagcaccttcgcgccaggagaaagctgcctggatg
agcgacataagtcagtgtgtggacaatatacggtgtaatggtttaatgactatagtattt
gaagagaattccaaagttactgtgccacatatgattaaatctgatgcccgtcttcataaa
gatgacaccgacatttgcttcagtaaaacactcaactcctgcaaagtgccacagatccgc
tacgccagcgtggagcgcctcctggagcggctgacagacttgcggtttcttagtatcgat
ttcctcaacacctttctgcacacctatcgtattttcacaacggcagctgtggtgctggcg
aaactttccgacatatacaagaggcctttcacctccatccctgtcaggtcattagaattg
ttttttgccaccagccagaacaacagaggtgaacatttggtggatggcaaatccccacgc
ctgtgtcgcaaattctcttccccgccaccgctggctgtgtctaggacgtcctccccagtg
agggccagaaagctgtccttgacgtctccattgaactcaaggataggagcgttggacctg
accacctgctcagcgtccagcagccctaccaccacctacagccctgctgcctccccaccg
ccgcacactggcaaagtaccgttggatctcagcagaggcctgccttctccagagcaaagc
ccgggatctgtagaggagcctatagataacccccgcatggatctgtgtaacaagctaaaa
cgaagtattcaaagagctgtcctagagtctgtgcccatggaccgagcaggagtggaaagt
tccccggtggcggacagcacggacctttcaccttgccggtcaccctccacgcctcagcac
ctccgttatcgtcagcctgtaggacagacggccgacaactcgcactgctctgtttcgccg
gcgtctgcctttgcgattgccacggcggctgcaggacacggaagtcccccaggatttaac
aacaccgagaggacttgcgacaaggagtttattattcggagaacagccaccaatcgagtc
ctgaacgtcctccgtcactgggtctcaaagcacgcacaggattttgaactcaacaacgaa
ctaaagatgaatgtcctcaatttgctagaagaagttttgcgagacccagaccttcttccc
caggaaaggaaggccacggcgaatatcctgagggccctttcacaagatgatcaagatgac
atccacctaaaattagaagatataattcaactgacagactgtgcaaaggctgagtgcttt
gagaccctgtcagccatggagctggcggagcagatcaccctcctggaccacgtcatcttc
agaagcattccctacgaagaatttcttgggcaggggtggatgaagctggataaaaatgaa
agaacaccttacattatgaaaaccagccaacacttcaatgatatgagtaacctggtggcc
tcccagataatgaattatgccgatgtcagctcccgtgccaacgcgatagagaagtgggtg
gccgtggcagacatttgccgatgcctgcacaactacaatggcgtgctggagatcacctca
gccttaaacagaagtgccatctacaggctgaagaaaacctgggccaaggtgtccaagcag
acaaaagctctcatggacaagcttcagaaaactgtttcatctgaaggaagatttaaaaat
ctcagagaaacccttaaaaactgtaaccccccagccgttccttatctggggatgtacctg
acagatctggcatttattgaagagggaacaccaaactttactgaggaaggccttgttaat
ttctccaagatgagaatgatatcacacatcatcagagagatacgccaattccagcagact
tgctatcgaatagaccatcagccaaaggtcactcagtacctgcttgacaaagccctcatc
atagatgaagatacgctgtatgaactgtcactaaaaattgaacctcggctccctgcttga

DBGET integrated database retrieval system