KEGG   Ailuropoda melanoleuca (giant panda): 100473097Help
Entry
100473097         CDS       T01329                                 

Gene name
RASGRF2
Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 2
  KO
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100473097 (RASGRF2)
   04010 MAPK signaling pathway
    100473097 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1047 aa AA seqDB search
MEDQSSELPRRLVQNPWVQVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMV
EAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKA
RIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPAC
EGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRIMHDEVSD
TENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGE
RQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDSKGSGQVFGHLDF
KIVVEPPDSAPFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMI
KSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIF
TTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPRLCRKFSSPPPLA
VSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTTTYSPAASPPPHTGKVPLDLSR
GLPSPEQSPGSVEEPIDNPRMDLCNKLKRSIQRAVLESVPMDRAGVESSPVADSTDLSPC
RSPSTPQHLRYRQPVGQTADNSHCSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEFII
RRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRA
LSQDDQDDIHLKLEDIIQLTDCAKAECFETLSAMELAEQITLLDHVIFRSIPYEEFLGQG
WMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNY
NGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPA
VPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTCYRIDHQPKVTQ
YLLDKALIIDEDTLYELSLKIEPRLPA
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccagagttcagagttacccagaaggttagtgcagaacccttgggttcaggtt
cagagcttcatgagaggatggttgtgtagaaggaaatggaagactattgtgcaggattac
atttgttctcctcatgctgaaagtatgaggaagagaaaccagattgtgttcaccatggtt
gaagccgagtcagagtatgttcaccagctctacatcctggtcaatggcttcctccggccc
ctgagaatggcggccagctccaagaagcctcccatcagccatgatgatgtcagcagcatt
tttctcaacagcgaaacgatcatgtttcttcatgaaatatttcaccaaggactgaaagca
aggatagcaaactggcctactctaattttagctgatttgtttgatattttgctccccatg
ttgaacatttatcaagaatttgtgcgtaatcaccagtacagcctccaagtgcttgccaat
tgtaagcaaaacagagattttgacaaactcttaaaacagtatgaagccaaccctgcctgt
gaggggaggatgctggaaacgttcctgacctatccaatgttccagatccccaggtatatc
atcacacttcatgaactcctagctcatactccccatgagcatgtggaaaggaaaagtctg
gagtttgctaaatcgaaactagaggaactatccaggataatgcatgatgaagtgagtgac
actgaaaacataaggaagaaccttgccatagaaagaatgatcgtagagggctgtgatatc
ttgctggacaccagccagactttcatccgccaaggttctcttattcaagtaccttctgtt
gagagggggaaacttagtaaagttcgcctgggttcattgtctttgaaaaaggaaggagaa
agacaatgcttcttatttacaaaacactttttaatttgtacgagaagctcgggaggaaag
ctgcatctgctcaagacaggtggggttctctctctaatagaatgtacgttgattgaggag
cctgatgcaagtgatgatgactccaaaggttctgggcaagtgttcggacacctggatttt
aaaatagtagtggagccccctgattctgcccccttcactgtagtcttgttagcaccttcg
cgccaggagaaagctgcctggatgagcgacataagtcagtgtgtggacaatatacggtgt
aatggtttaatgactatagtatttgaagagaattccaaagttactgtgccacatatgatt
aaatctgatgcccgtcttcataaagatgacaccgacatttgcttcagtaaaacactcaac
tcctgcaaagtgccacagatccgctacgccagcgtggagcgcctcctggagcggctgaca
gacttgcggtttcttagtatcgatttcctcaacacctttctgcacacctatcgtattttc
acaacggcagctgtggtgctggcgaaactttccgacatatacaagaggcctttcacctcc
atccctgtcaggtcattagaattgttttttgccaccagccagaacaacagaggtgaacat
ttggtggatggcaaatccccacgcctgtgtcgcaaattctcttccccgccaccgctggct
gtgtctaggacgtcctccccagtgagggccagaaagctgtccttgacgtctccattgaac
tcaaggataggagcgttggacctgaccacctgctcagcgtccagcagccctaccaccacc
tacagccctgctgcctccccaccgccgcacactggcaaagtaccgttggatctcagcaga
ggcctgccttctccagagcaaagcccgggatctgtagaggagcctatagataacccccgc
atggatctgtgtaacaagctaaaacgaagtattcaaagagctgtcctagagtctgtgccc
atggaccgagcaggagtggaaagttccccggtggcggacagcacggacctttcaccttgc
cggtcaccctccacgcctcagcacctccgttatcgtcagcctgtaggacagacggccgac
aactcgcactgctctgtttcgccggcgtctgcctttgcgattgccacggcggctgcagga
cacggaagtcccccaggatttaacaacaccgagaggacttgcgacaaggagtttattatt
cggagaacagccaccaatcgagtcctgaacgtcctccgtcactgggtctcaaagcacgca
caggattttgaactcaacaacgaactaaagatgaatgtcctcaatttgctagaagaagtt
ttgcgagacccagaccttcttccccaggaaaggaaggccacggcgaatatcctgagggcc
ctttcacaagatgatcaagatgacatccacctaaaattagaagatataattcaactgaca
gactgtgcaaaggctgagtgctttgagaccctgtcagccatggagctggcggagcagatc
accctcctggaccacgtcatcttcagaagcattccctacgaagaatttcttgggcagggg
tggatgaagctggataaaaatgaaagaacaccttacattatgaaaaccagccaacacttc
aatgatatgagtaacctggtggcctcccagataatgaattatgccgatgtcagctcccgt
gccaacgcgatagagaagtgggtggccgtggcagacatttgccgatgcctgcacaactac
aatggcgtgctggagatcacctcagccttaaacagaagtgccatctacaggctgaagaaa
acctgggccaaggtgtccaagcagacaaaagctctcatggacaagcttcagaaaactgtt
tcatctgaaggaagatttaaaaatctcagagaaacccttaaaaactgtaaccccccagcc
gttccttatctggggatgtacctgacagatctggcatttattgaagagggaacaccaaac
tttactgaggaaggccttgttaatttctccaagatgagaatgatatcacacatcatcaga
gagatacgccaattccagcagacttgctatcgaatagaccatcagccaaaggtcactcag
tacctgcttgacaaagccctcatcatagatgaagatacgctgtatgaactgtcactaaaa
attgaacctcggctccctgcttga

DBGET integrated database retrieval system