KEGG   Ailuropoda melanoleuca (giant panda): 100473120Help
Entry
100473120         CDS       T01329                                 

Definition
glutathione peroxidase 3-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aml00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aml00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:aml04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 226 aa AA seqDB search
MARLLRASCLLSLLLAGFVPPSRGQEKSKTDCHAGVSGTIYEYGALTIDGEEYIPFKQYA
GKYVLFVNVASYXGLTDQYLELNALQEELEPFGLVILGFPCNQFGKQEPGENSEILPSLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGSPGRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWYHRTTVNTVKMDILAYMRRQAGLAVKGK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctgctgcgggcgtcctgccttctctccctgctcctggctggcttcgtcccg
ccgagccgggggcaggagaagtcgaagacggactgccacgctggcgtgagtggtaccatc
tatgagtacggagccctcaccatcgacggggaggagtacatccccttcaagcagtacgct
ggcaaatacgtcctctttgtcaacgtggccagctactgaggcctgacagaccagtacctt
gaactgaatgcactacaggaagagcttgaaccatttggtctggtcattctgggcttcccc
tgcaaccaatttggaaaacaggagccaggagagaattcggaaatcctacccagcctcaag
tatgtccgaccgggcgggggcttcgtccccaatttccaactgtttgagaaaggggatgtg
aacggggagaaagagcagaagttctacacgttcctgaagaactcctgccctcccacctcg
gagctcctgggctcacctggccgcctcttctgggaacccatgaaggtccatgacatccgc
tggaactttgagaagttcctggtggggccagatggtatacccatcatgcgctggtaccac
cggaccacggtcaacactgtcaagatggacatcctggcctacatgaggcggcaggcaggc
ctggccgtcaaggggaagtaa

DBGET integrated database retrieval system