KEGG   Ailuropoda melanoleuca (giant panda): 100473240Help
Entry
100473240         CDS       T01329                                 

Definition
protein unc-13 homolog A-like
Orthology
K15293  
protein unc-13
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100473240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1714 aa AA seqDB search
MEKVAGQRCDDYGGEGDSDSDRLLTGKTEIKKAKFDGAQEKFNTYVTLKVQNVKSTTIAV
RGSQPSWEQDFMFEINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLT
LDSQVIMADSEICGTKDPTFHRILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYS
FQDEQDKPLPVPSNQCCNWNYFGWGEQQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQ
PNASVHQYSVRPPPLGSRESYSDSMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSE
DFDPDEQSLQGSEMEDERDRDSYHSCHSSVSYHKDSPRWDQDEEELDEELDEELDEDLED
FLEEEEELEEEEEVPDDIRSYTQREEVAVAEPKDFKRVSLPSAASEKEEKALAVAAEAHD
VAKGAPEPGAPEEVPTADRAPETEAPKSEESFRRREDEEGQEGQDSMSRAKANWLRAFNK
VRLQLQEARGEGEMSKSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAG
ITSALASSTLNNEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGI
ARQGMRMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRE
RNKPEIFELIQEIFAVTKTAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTG
SSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQ
RFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPY
HVQYTCLHENLFHFVTDVQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIY
QAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVK
LLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQV
VKDCVKACLNSTYEYIFNNCHELYSREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLI
VSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMN
LHFKVKWLYNEYVAELPAFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDG
FQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADI
ISKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASDILKELQVKLNN
VLDELSRVFATSFQPHIEECVKQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLL
DSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTDQTGTLLRKHGKGLEKGTQ
MIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEK
SPDLQSLRYALSLYTQATDLLIKTFVQTQAAQGSGVEDPVGEVSVHVELFTHPGTGEHKV
TVKVVAANDLKWQTSGIFRPFIEVNIIGPQLSDKKRKFATKSKNNSWAPKYNESFQFTLS
ADAGPECYELQVCVKDYCFAREDRTVGLAVLQLRELAQRGSAACWXGRRIHMDDTGLTVL
RILSQRSNDEVAKEFVKLKSDTRSAEEGGAAPAP
NT seq 5145 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagtggcagggcagagatgtgatgactatggtggtgaaggcgacagcgactcg
gaccgtttactgacagggaagacagaaatcaaaaaagccaagtttgatggtgcccaagag
aaattcaacacgtacgtgaccctgaaggtgcaaaatgtcaagagcacgaccatcgctgtg
cggggcagccagcccagctgggagcaggatttcatgtttgagattaaccgcctggatttg
gggctgacagtggaggtgtggaacaagggtctcatctgggacacaatggtgggcaccgtg
tggattcccctgcggaccatccgccagtccaatgaagagggccctggagagtggctgaca
ctggactctcaggtcatcatggcggacagtgagatctgcggcaccaaggaccccaccttc
caccgcatcctccttgacacccgctttgagctgcctttagacattcccgaggaggaggcg
cgctactgggcgaagaagctggagcagctaaatgccatgcgggaccaggatgagtattca
tttcaagatgaacaagacaagcctctccctgtccccagcaaccagtgttgcaactggaat
tattttggctggggtgagcagcagaatgatgacccggacagcgcagtggatgatcgtgac
agtgactatcgcagcgagacaagcaacagcatcccgccaccctattacactacatcccag
cccaatgcctcagtccaccagtattctgtccgtccaccacccctgggttcccgggaatcg
tacagtgactccatgcacagttatgaggagttctccgagccacgggccctcagccccact
ggcagtagccgctatgcctcctcgggggaactgagccagggcagctcgcagctgagcgag
gacttcgaccccgacgagcagagtctgcagggctccgagatggaggacgagcgggaccgg
gactcctaccactcctgccacagctcggtcagttaccacaaggactcgccgcgctgggac
caggatgaggaggagctggacgaagaactggacgaggagctggatgaggacctggaggac
ttcctggaggaggaggaggagctggaggaggaagaggaggtgcctgatgacatccgtagc
tacacgcagcgtgaagaggtggccgtggctgaacccaaagactttaagcgagtcagcctc
ccatcggccgcatctgagaaggaggagaaggctctggctgtagctgccgaggcccacgac
gtggccaagggagccccggagccaggtgcacccgaggaggtgcccacagctgaccgggcc
ccagagacggaagctcccaagtctgaggagagtttcaggcgacgagaggatgaggaaggc
caggagggtcaggactccatgtcccgggccaaagccaactggcttcgagccttcaacaaa
gtacggctgcagctgcaggaggcccgaggagaaggagagatgtctaaatccctatggttc
aaaggcggccctggaggtggcctcatcatcattgacagcatgccagacatccgcaaaagg
aagcccattccactcgtgagcgacctggccatgtccctggtccagtccagaaaagccggc
atcacctcggccttggcctccagcactttgaacaacgaggagctgaaaaaccacgtttac
aagaagaccctgcaagccttaatctatcccatctcctgcacgacgccgcacaacttcgag
gtgtggacggccaccacgcccacctactgctacgagtgcgaggggctgctgtggggcatc
gcgcggcagggcatgcgcatgcgctgcaccgagtgcggcgtcaagtgccacgagaagtgc
caggacctgctcaacgcggattgcctgcagcgggctgcggagaagagctccaagcatggg
gcggaggaccggacgcagaacatcatcatggtgctcaaggaccgcatgaagatccgggag
cgcaacaaacctgagatcttcgagctcatccaggagatcttcgccgtgaccaagaccgcg
catacgcagcagatgaaggcggtcaaacagagcgtgctggacggcacatccaagtggtcg
gccaagatcagcatcactgtggtctgtgcccagggcttgcaggcaaaggacaagacggga
tccagtgacccctatgtcactgttcaggttgggaagaccaagaaacggacaaaaaccatc
tatgggaacctgaaccctgtgtgggaggagaacttccactttgaatgtcacaactcctca
gaccgaatcaaggtgcgtgtctgggatgaggatgatgacatcaaatcccgggtgaagcag
cggtttaagagggaatctgatgactttctgggacagacgatcatcgaggtgcggacactc
agcggcgagatggacgtgtggtataacctggataagcggactgacaaatccgctgtgtca
ggtgccatccggctacacatcagtgtggagatcaaaggtgaagaaaaggtggccccctac
catgtccagtacacctgtctgcatgagaacctgttccacttcgtgacagacgtgcagaac
aatggggttgtgaagatcccagatgccaagggtgatgacgcctggaaggtttactatgat
gagacagcccaggaaattgtggatgaatttgccatgcgctatggcgtggagtccatctac
caagccatgacccactttgcctgcctctcctccaagtacatgtgtcctggggtgcctgcc
gtcatgagcaccctgctcgccaacatcaatgcctactatgcgcacaccaccgcctccacc
aacgtgtccgcctctgaccgctttgctgcctccaactttgggaaagagcgctttgtcaag
ctcctggaccagctgcacaactccctgcggatcgacctctccatgtatcggaataacttc
ccagccagcagcccagagagactccaggaccttaaatccactgtggaccttctcaccagc
atcaccttctttcggatgaaggtgcaagaactccagagcccaccccgagccagtcaggtg
gtgaaagactgtgtgaaagcctgcctcaactctacctatgagtacatcttcaacaactgt
catgaactctatagtcgggagtaccagacagacccggccaagaagggagaagttccccca
gaggaacagggacccagcattaagaaccttgacttctggtccaagctgattactctcata
gtgtccatcattgaggaagacaagaattcctacactccctgcctcaaccagtttccccag
gagctgaatgtgggtaaaatcagtgctgaagtgatgtggaacctgtttgcccaggacatg
aagtatgccatggaggagcatgataaacatcgcctgtgcaagagcgctgactacatgaac
ctacacttcaaggtcaagtggctgtacaatgagtacgtggcagagcttcctgccttcaag
gaccgcgtgcctgagtaccctgcgtggtttgagccttttgtcatccagtggttggacgag
aatgaggaggtgtcgcgggatttcctgcacggggccctggaacgagacaagaaggatggg
ttccagcagacctcagagcatgccctattctcctgctccgtggtggacgtcttctcccag
ctcaaccagagctttgagatcatcaagaaacttgagtgtcctgacccccagatcgtgggg
cactatatgaggcgctttgccaagaccatcagtaatgtgctcctccagtatgcggacatc
atctccaaggatttcgcctcctactgctccaaggagaaggagaaagtgccctgcatcctc
atgaacaacacacagcagctccgagtgcagctagagaagatgtttgaagccatgggagga
aaggagctggatgccgaggccagtgacatcttgaaggagctccaggtcaaactcaacaat
gtcttggacgagctcagccgggtgtttgctaccagcttccagccacacattgaggagtgc
gtcaagcagatgggcgacatccttagccaggtgaagggcacgggtaatgtgccagccagt
gcctgcagcagcgtggcccaggatgctgacaatgtgctgcaacccatcatggacctgctg
gacagcaacctgactctctttgccaaaatctgtgagaagacggtgctgaagagggtgcta
aaggagttatggaagctggtcatgaacaccatggagaaaaccatcgtcctgccacccctc
actgaccagacgggcaccctcttgagaaaacatggcaagggattagaaaagggaacccag
atgatcttcaatgcagccaaagagctgggtcagctgtctaaactcaaggaccacatggta
cgagaagaagccaagagcttgaccccgaagcagtgtgcagtagtcgaactggccctggac
accatcaagcaatacttccacgcaggtggcgtgggcctcaagaagaccttcctggagaag
agcccagacctgcagtccctgcgctacgccctgtccctctacacgcaggccacggacctg
ctcatcaagaccttcgtgcagacgcaagcagcccagggctcgggtgtggaagaccctgtg
ggtgaagtttcagtccacgtggagctcttcactcatccaggaactggggaacacaaggtc
actgtgaaagtcgtggctgccaatgacctcaagtggcagacttctggcattttccggcca
ttcatcgaagtcaacatcattgggccccagctcagcgacaagaaacgcaagtttgccacc
aaatccaagaataacagctgggcccccaagtacaacgagagcttccagttcacgctgagc
gccgacgcgggcccggagtgctacgagctgcaggtgtgcgtcaaggactattgcttcgcg
cgcgaggaccgcaccgtggggctggccgtgctgcagctgcgggagctggcccagcgcggg
agcgccgcctgctggncgggccgccgcatccatatggacgacacgggcctcacggtgctg
cgcatcctgtcacagcgcagcaacgacgaggtggccaaggagttcgtcaagctcaagtcg
gacacgcgctccgccgaggagggcggtgccgcgcctgcgccctag

DBGET integrated database retrieval system