KEGG   Ailuropoda melanoleuca (giant panda): 100473240Help
Entry
100473240         CDS       T01329                                 

Gene name
UNC13A
Definition
(RefSeq) unc-13 homolog A
  KO
K15293  
protein unc-13 A/B/C
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100473240 (UNC13A)
Membrane trafficking [BR:aml04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100473240 (UNC13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 1698 aa AA seqDB search
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEQSLQGSEMEDERDRDS
YHSCHSSVSYHKDSPRWDQDEEELDEELDEELDEDLEDFLEEEEELEEEEEVPDDIRSYT
QREEVAVAEPKDFKRVSLPSAASEKEEKALAVAAEAHDVAKGAPEPGAPEEVPTADRAPE
TEAPKSEESFRRREDEEGQEGQDSMSRAKANWLRAFNKVRLQLQEARGEGEMSKSLWFKG
GPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEELKNHVYKK
TLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRMRCTECGVKCHEKCQD
LLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVTKTAHT
QQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYG
NLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSG
EMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDVQNNG
VVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVM
STLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPA
SSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHE
LYSREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQEL
NVGKISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVAELPAFKDR
VPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLN
QSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYCSKEKEKVPCILMN
NTQQLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFATSFQPHIEECVK
QMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKE
LWKLVMNTMEKTIVLPPLTDQTGTQMIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVV
ELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIKTFVQTQAAQVHG
GKGTRFTLSEDIYPEKGSGVEDPVGEVSVHVELFTHPGTGEHKVTVKVVAANDLKWQTSG
IFRPFIEVNIIGPQLSDKKRKFATKSKNNSWAPKYNESFQFTLSADAGPECYELQVCVKD
YCFAREDRTVGLAVLQLRELAQRGSAACWXGRRIHMDDTGLTVLRILSQRSNDEVAKEFV
KLKSDTRSAEEGGAAPAP
NT seq 5097 nt NT seq  +upstreamnt  +downstreamnt
atgtctctactttgcgttggagtcaaaaaagccaagtttgatggtgcccaagagaaattc
aacacgtacgtgaccctgaaggtgcaaaatgtcaagagcacgaccatcgctgtgcggggc
agccagcccagctgggagcaggatttcatgtttgagattaaccgcctggatttggggctg
acagtggaggtgtggaacaagggtctcatctgggacacaatggtgggcaccgtgtggatt
cccctgcggaccatccgccagtccaatgaagagggccctggagagtggctgacactggac
tctcaggtcatcatggcggacagtgagatctgcggcaccaaggaccccaccttccaccgc
atcctccttgacacccgctttgagctgcctttagacattcccgaggaggaggcgcgctac
tgggcgaagaagctggagcagctaaatgccatgcgggaccaggatgagtattcatttcaa
gatgaacaagacaagcctctccctgtccccagcaaccagtgttgcaactggaattatttt
ggctggggtgagcagcagaatgatgacccggacagcgcagtggatgatcgtgacagtgac
tatcgcagcgagacaagcaacagcatcccgccaccctattacactacatcccagcccaat
gcctcagtccaccagtattctgtccgtccaccacccctgggttcccgggaatcgtacagt
gactccatgcacagttatgaggagttctccgagccacgggccctcagccccactggcagt
agccgctatgcctcctcgggggaactgagccagggcagctcgcagctgagcgaggacttc
gaccccgacgagcagagtctgcagggctccgagatggaggacgagcgggaccgggactcc
taccactcctgccacagctcggtcagttaccacaaggactcgccgcgctgggaccaggat
gaggaggagctggacgaagaactggacgaggagctggatgaggacctggaggacttcctg
gaggaggaggaggagctggaggaggaagaggaggtgcctgatgacatccgtagctacacg
cagcgtgaagaggtggccgtggctgaacccaaagactttaagcgagtcagcctcccatcg
gccgcatctgagaaggaggagaaggctctggctgtagctgccgaggcccacgacgtggcc
aagggagccccggagccaggtgcacccgaggaggtgcccacagctgaccgggccccagag
acggaagctcccaagtctgaggagagtttcaggcgacgagaggatgaggaaggccaggag
ggtcaggactccatgtcccgggccaaagccaactggcttcgagccttcaacaaagtacgg
ctgcagctgcaggaggcccgaggagaaggagagatgtctaaatccctatggttcaaaggc
ggccctggaggtggcctcatcatcattgacagcatgccagacatccgcaaaaggaagccc
attccactcgtgagcgacctggccatgtccctggtccagtccagaaaagccggcatcacc
tcggccttggcctccagcactttgaacaacgaggagctgaaaaaccacgtttacaagaag
accctgcaagccttaatctatcccatctcctgcacgacgccgcacaacttcgaggtgtgg
acggccaccacgcccacctactgctacgagtgcgaggggctgctgtggggcatcgcgcgg
cagggcatgcgcatgcgctgcaccgagtgcggcgtcaagtgccacgagaagtgccaggac
ctgctcaacgcggattgcctgcagcgggctgcggagaagagctccaagcatggggcggag
gaccggacgcagaacatcatcatggtgctcaaggaccgcatgaagatccgggagcgcaac
aaacctgagatcttcgagctcatccaggagatcttcgccgtgaccaagaccgcgcatacg
cagcagatgaaggcggtcaaacagagcgtgctggacggcacatccaagtggtcggccaag
atcagcatcactgtggtctgtgcccagggcttgcaggcaaaggacaagacgggatccagt
gacccctatgtcactgttcaggttgggaagaccaagaaacggacaaaaaccatctatggg
aacctgaaccctgtgtgggaggagaacttccactttgaatgtcacaactcctcagaccga
atcaaggtgcgtgtctgggatgaggatgatgacatcaaatcccgggtgaagcagcggttt
aagagggaatctgatgactttctgggacagacgatcatcgaggtgcggacactcagcggc
gagatggacgtgtggtataacctggataagcggactgacaaatccgctgtgtcaggtgcc
atccggctacacatcagtgtggagatcaaaggtgaagaaaaggtggccccctaccatgtc
cagtacacctgtctgcatgagaacctgttccacttcgtgacagacgtgcagaacaatggg
gttgtgaagatcccagatgccaagggtgatgacgcctggaaggtttactatgatgagaca
gcccaggaaattgtggatgaatttgccatgcgctatggcgtggagtccatctaccaagcc
atgacccactttgcctgcctctcctccaagtacatgtgtcctggggtgcctgccgtcatg
agcaccctgctcgccaacatcaatgcctactatgcgcacaccaccgcctccaccaacgtg
tccgcctctgaccgctttgctgcctccaactttgggaaagagcgctttgtcaagctcctg
gaccagctgcacaactccctgcggatcgacctctccatgtatcggaataacttcccagcc
agcagcccagagagactccaggaccttaaatccactgtggaccttctcaccagcatcacc
ttctttcggatgaaggtgcaagaactccagagcccaccccgagccagtcaggtggtgaaa
gactgtgtgaaagcctgcctcaactctacctatgagtacatcttcaacaactgtcatgaa
ctctatagtcgggagtaccagacagacccggccaagaagggagaagttcccccagaggaa
cagggacccagcattaagaaccttgacttctggtccaagctgattactctcatagtgtcc
atcattgaggaagacaagaattcctacactccctgcctcaaccagtttccccaggagctg
aatgtgggtaaaatcagtgctgaagtgatgtggaacctgtttgcccaggacatgaagtat
gccatggaggagcatgataaacatcgcctgtgcaagagcgctgactacatgaacctacac
ttcaaggtcaagtggctgtacaatgagtacgtggcagagcttcctgccttcaaggaccgc
gtgcctgagtaccctgcgtggtttgagccttttgtcatccagtggttggacgagaatgag
gaggtgtcgcgggatttcctgcacggggccctggaacgagacaagaaggatgggttccag
cagacctcagagcatgccctattctcctgctccgtggtggacgtcttctcccagctcaac
cagagctttgagatcatcaagaaacttgagtgtcctgacccccagatcgtggggcactat
atgaggcgctttgccaagaccatcagtaatgtgctcctccagtatgcggacatcatctcc
aaggatttcgcctcctactgctccaaggagaaggagaaagtgccctgcatcctcatgaac
aacacacagcagctccgagtgcagctagagaagatgtttgaagccatgggaggaaaggag
ctggatgccgaggccagtgacatcttgaaggagctccaggtcaaactcaacaatgtcttg
gacgagctcagccgggtgtttgctaccagcttccagccacacattgaggagtgcgtcaag
cagatgggcgacatccttagccaggtgaagggcacgggtaatgtgccagccagtgcctgc
agcagcgtggcccaggatgctgacaatgtgctgcaacccatcatggacctgctggacagc
aacctgactctctttgccaaaatctgtgagaagacggtgctgaagagggtgctaaaggag
ttatggaagctggtcatgaacaccatggagaaaaccatcgtcctgccacccctcactgac
cagacgggaacccagatgatcttcaatgcagccaaagagctgggtcagctgtctaaactc
aaggaccacatggtacgagaagaagccaagagcttgaccccgaagcagtgtgcagtagtc
gaactggccctggacaccatcaagcaatacttccacgcaggtggcgtgggcctcaagaag
accttcctggagaagagcccagacctgcagtccctgcgctacgccctgtccctctacacg
caggccacggacctgctcatcaagaccttcgtgcagacgcaagcagcccaggtccatggt
ggaaaagggactaggtttacccttagtgaagacatttatcctgagaagggctcgggtgtg
gaagaccctgtgggtgaagtttcagtccacgtggagctcttcactcatccaggaactggg
gaacacaaggtcactgtgaaagtcgtggctgccaatgacctcaagtggcagacttctggc
attttccggccattcatcgaagtcaacatcattgggccccagctcagcgacaagaaacgc
aagtttgccaccaaatccaagaataacagctgggcccccaagtacaacgagagcttccag
ttcacgctgagcgccgacgcgggcccggagtgctacgagctgcaggtgtgcgtcaaggac
tattgcttcgcgcgcgaggaccgcaccgtggggctggccgtgctgcagctgcgggagctg
gcccagcgcgggagcgccgcctgctggncgggccgccgcatccatatggacgacacgggc
ctcacggtgctgcgcatcctgtcacagcgcagcaacgacgaggtggccaaggagttcgtc
aagctcaagtcggacacgcgctccgccgaggagggcggtgccgcgcctgcgccctag

DBGET integrated database retrieval system