KEGG   Ailuropoda melanoleuca (giant panda): 100473303Help
Entry
100473303         CDS       T01329                                 

Gene name
UNC13C
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:aml04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2216 aa AA seqDB search
MVANLFKSLILPYIHKLCKGMFTKKLGNTTKKKENHQQKKDQDFPTAGQTKTPKFSNTLK
STVKKIAKCSTTRNLSTEEEEANKEFSLSPTFSYRVAIANGLQKNINVTSSDNEDRLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHSLKLGA
LRKLRKWKKSQECVSSDSELSTMKKTWGIRSKSLDRTARNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHVGSKASLRFLNVPEERFEYVESVVYQILIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKERG
IPSSQTYESMDIKLSTPEPKTKNNWQSPDDSDGELKSDLNRNSYAVFSKSEFPTKGSTSK
SSSKSHNARAKNKTASSSRISNKSDYDKISSQLPESDNLEKQTTTHYADATPLWHSQNDF
FTGKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTPTLYDSL
QDQHSNGAVQGVQGQSEIENTETVDSGMSNGMAFASGDQSHYSESQLSLHEDLSPWKEWS
QVEQGADLGLDSSTQEAFDYDTNSLPDQQLDIYNKDLEDLGKCPSDLQDDSESYDFTQDD
NSSPCPGLDNEPQGQWVGQYDSYQEANSNELYQNQNQLPRMYRSQSELQSDDSEDAPPKS
WHSRLSIDLSDKAFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQ
STANESSTTLDSDVYTEPFYYKAEDEEDYSEPVADNETDYVEVMEQVLAKLENRTSMTET
DEQMQVYDHPSYETPYETPQDEGYDGQADDVVREGGLEPLNEIPAEMEIREDENQNIPEQ
PVEITKPKRIRPSFKEAALKAYKKQMAELEEKILAGDSSSMDEKARIVSGSDLDASKFSG
LQAIGGAGRGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKI
HVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEK
CQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKE
DFVRYTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKT
IFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRT
LSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVK
SNGGVKIPEVKGEEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVP
AVMSTLLANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYR
ENFPASNAERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIF
DNCHELYSQLIDPSKKQDIPREDQGPTTKNLDFWPQIITLMVTIIDEDKTAYTPVLNQFP
QELNMGKISAEIMWTLFAQDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAF
KDAVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFPQTSDHALFSCSVVDVFA
QLNQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSYCDKENVPCILM
NNIQQLRVQLEKMFESMGGKELDPEASTILKELQVKLNGALDELSITYGESFQHIIEECI
KQMSFELNQMRTNGNTASNKNSSAMDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRILKE
LWKLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDAKGLTPRQCAVM
EVVLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSRP
SKDSVGQISVHVDITATPGTGEHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDKK
RKQGTKTKSNTWSPKYNETFQFILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQN
IAEKGSYGSWYPLLKNVSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSAEESA
NT seq 6651 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaatcttttcaagagcctgattttaccttacatacataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaccaaaaaaaaagagaatcatcagcagaaaaag
gatcaagactttcctactgctggccagaccaaaacccccaaattttctaataccttaaaa
agcactgtaaagaagattgcaaagtgttcaactactcgcaacttatccactgaagaggag
gaggctaataaagagttttccctttctccaacattcagttaccgagtagctattgccaat
ggcctacaaaagaatattaatgtaaccagcagtgataatgaggatcggcttcaagagtta
tcttcaattgagagttcctattcagaatcactcaatgaactaaggagtagtacagaaaac
caggcacaatcaacacacacaatgccagttagacgtaacagaaagagttcaagcagtctg
gccccctctgagggcagctctgatggagaacgcactctacatagcttgaaactaggagcg
ttacgcaaactgagaaaatggaaaaagagtcaggagtgtgtctcatcagattcagagttg
agcacaatgaagaaaacctggggaataagaagtaaatctttggacagaactgcacgaaac
ccaaagacaaatgccctggagccaggattcagttcctctgggtgcattagccaaacacat
gatgtcatggaaatgatctttaaggaacttcagggtataagtcagattgaaacggaactt
tctgaactacgagggcatgtcaatgccctcaagcattccatcgatgagatctccagcagt
gtagaggttgtacagagtgaaattgaacagctacgcacagggtttgtccagtcgcgaagg
gaaaccagagacatccatgattatattaaacacttaggtcatgtgggtagtaaggcaagc
ctgagatttctaaatgtgcctgaagaaagatttgaatacgttgaaagtgtggtataccaa
attctaatagataagatgggtttctcagatgcaccaaatgctattaaaattgaatttgct
caaaggatagggcaccagagggactgcccaaatgcaaagcctcgacccatacttgtgtac
tttgaaacccctcagcaaagggattctgtcttaaaaaaatcctacaaactcaaaggaaca
ggaattggaatctcaacagatattcttactcatgacataagagaaagaaaagagagaggg
ataccgtcctcccagacatatgagagcatggatataaagctgtctactccagagcccaaa
accaagaacaattggcagtcacctgatgacagtgatggagagctgaaatctgacctcaat
agaaacagttatgctgtgttttccaagtcagagtttccaacaaaaggaagtacttccaag
tcaagttcaaaatcacacaatgctagagccaagaataaaactgctagtagcagcagaatt
tcaaataaatccgattatgataaaatttcctcacaattgccagaatcagataatttggaa
aaacaaactacaacccattatgcagatgctacacccctctggcattcacagaatgatttt
ttcactggtaaacttagtcgttctgaatcagatttttccaaattgtgtcagtcttactca
gaggatttttcagaaaatcagtttttcactagaactaatggaagctccctcctgtcatct
tcagaccgggaactttggcagaggaaacaggagggcacacccaccttgtatgacagtctg
caggatcaacattcgaatggggctgttcagggtgtccaagggcagagcgaaattgagaac
acagaaactgtggatagcggaatgagtaatggcatggcgtttgcatcgggagaccaaagt
cattacagtgagtctcagctctctttacatgaggatctttctccatggaaggaatggagt
caagtagagcaaggagctgacttagggttagattcatccacccaggaagcttttgactat
gacacaaacagtctacctgatcaacaactagatatttacaataaagacctagaagacttg
ggaaagtgccctagtgaccttcaggatgactctgagagctatgatttcacgcaagatgac
aactcatctccatgccctgggttggataatgaaccacaaggccagtgggttggccaatat
gattcttatcaggaagctaattctaatgagctgtaccaaaatcaaaaccaattgcccagg
atgtatcgaagtcaaagtgaattgcaaagtgatgactcagaggatgccccacccaaatct
tggcatagtcgattaagcattgacctttctgataaggcttttagcttccccaaatttgga
tctacattacagagggctaaatcagccttggaagtggtatggaacaaaagcacacagagt
ctcagtgggtatgaagacagcggctcttccttaatggggagatttcggacattatcccaa
tcaactgcaaatgaatcaagtaccacccttgactctgatgtctacacagagcctttttac
tacaaagcagaggatgaggaggactatagtgagccagtggctgataatgagacagattat
gttgaagtgatggaacaagtccttgctaagctagaaaacagaacgagtatgacggaaaca
gatgaacaaatgcaggtatatgatcacccttcatatgaaacaccctatgaaaccccacaa
gatgagggttatgatgggcaggcagatgatgtggttcgtgaagggggattggaaccatta
aatgaaataccagctgaaatggaaataagagaagatgaaaaccaaaacatccctgaacag
ccagtggaaatcacaaagccaaagagaatccgtccctctttcaaggaagcagctttaaaa
gcctataagaagcaaatggcagaattggaagagaagatcctggctggagatagcagttct
atggatgaaaaggctcggatagtaagtggcagtgatttggatgcttccaaattctctggg
ctccaggcgattggtggggctgggcgaggactttatggcattgacagtatgccagatctc
cgcaggaaaaaaactttgcctattgtacgagatgtggccatgactctggctgcccggaaa
tctggactgtccctggctatggtgatcaggacgtcactcaacaatgaggaactgaaaata
catgtcttcaaaaagaccttgcaggcactgatctaccccatgtcctccaccaccccccac
aattttgaagtctggacggcaacaacacccacctactgttacgagtgtgaagggctcctg
tggggcattgctcggcaaggcatgaagtgtttggagtgcggagtgaagtgccatgagaag
tgtcaggacctcctaaatgctgactgtttgcagagagcagcagaaaagagttctaagcat
ggtgccgaagacaagactcagaccatcattacagctatgaaagaaagaatgaagattagg
gagaaaaacaggccagaggtgtttgaagtaattcaggagatgtttcagatttctaaagaa
gattttgtgaggtacacaaaagcggccaagcagagtgtcctagatgggacatctaagtgg
tcagcaaaaataaccattacagtggtttcagcacaaggcttacaggcaaaagacaaaaca
gggtcaagtgacccgtatgttactgttcaagtgggaaagaacaaaagaagaactaaaacc
atttttggaaacttgaatccagtatgggatgagaagttttattttgagtgtcataactcc
acagaccgaattaaagtcagagtgtgggatgaagatgatgacattaaatccagagtcaag
caacatttcaaaaaggagtcagatgactttttgggacaaacaattgtagaagtgagaacc
ctgagtggagagatggatgtctggtacaacttagagaaacggacagataagtcagctgtg
tctggggccattcgattgaaaattaatgtggaaataaaaggagaggagaaggttgcccca
tatcatatacagtatacatgtttacatgagaatctgttccattacttgactgaagtgaag
tctaatggtggagtgaaaatcccagaggtcaaaggggaggaagcctggaaggttttcttt
gatgatgcttcccaagaaatagtcgatgaatttgccatgcgttatgggattgaatccatt
tatcaagctatgacgcacttttcatgtctgtcttctaaatacatgtgccctggtgtccct
gctgtcatgagcaccttgttggcgaatataaatgctttctatgctcacacaacagtttca
acaaatgtacaggtttctgcttcagatcgatttgctgctaccaactttggtagggaaaaa
ttcataaaactactggaccaattgcataactctttaaggattgacctgtcaaagtatagg
gaaaactttcctgccagcaacgctgaacggctgcaagacctgaaatcaactgttgacctg
ctaacaagtatcaccttttttaggatgaaggttctggaactgcaaagccccccaaaggcc
agcatggtggtgaaggactgtgttagagcgtgcctggattctacgtacaaatatattttt
gacaattgccacgaactctattctcagctaatagacccgagtaagaaacaggacattcct
cgtgaagatcagggaccgacaactaagaatttggatttttggccccagattattacactg
atggttactattattgatgaggataaaactgcctacacgcctgtcctgaatcagtttcct
caagaactgaacatgggaaaaataagtgctgaaattatgtggaccctttttgctcaagat
atgaaatatgcactagaagaacatgagaagcagcggttatgcaagagcaccgattatatg
aatttgcatttcaaagtgaaatggttttataatgagtatgtgcgagaacttcctgccttc
aaggatgccgttcctgaatactccttgtggtttgagccttttgtcatgcagtggctggat
gaaaatgaagatgtatcaatggagttccttcatggagcgctaggaagagacaaaaaagat
ggattcccgcagacatctgatcatgccctcttctcttgttctgtggttgatgtcttcgct
cagcttaatcagagctttgagattattaagaaactggaatgccctaatcctgaagcatta
tctcatttaatgagaagatttgcaaagaccatcaataaagtactgcttcagtatgctgca
attgtatcaagtgacttcagttcatactgtgataaggaaaatgtgccttgtatattgatg
aacaatattcagcaactacgggtccagctggaaaaaatgtttgaatccatgggagggaaa
gagctagatcctgaagctagtactattctaaaggaacttcaagttaaactcaacggggct
ctggatgagctcagcatcacttatggtgaaagtttccagcatatcattgaagagtgtata
aaacagatgagttttgaactaaaccagatgagaacaaatggaaatactgcatctaacaag
aacagttcagcaatggatgcggagattgtattaagacccctcatggacttcttggacaaa
acattaagtctctcagcaaaaatctgtgagaaaacagtcctgaagcgaattttgaaggag
ttatggaagctagttcttaacaaaatagaaaaacaaattgttctccctcctctgacagat
caaacaggacctcagatgattttcatcgcagctaaagatcttggacaattatccaaactg
aaggagcacatgattcgagaggatgccaagggtctgactccaagacagtgcgctgtaatg
gaggtggtcttggctaccatcaagcaatactttcatgcaggaggaaatggcctgaaaaag
aatttcttggagaaaagcccagatcttcagtctctgagatatgctctcagtctttatacc
caaactactgatgccttgataaagaaattcatagacactcagacctcacagagtcgcccc
tccaaagattcagtgggtcagatatctgttcatgtggacatcactgctaccccgggaact
ggagagcataaagtcactgtaaaagtgattgctattaatgacctaaactggcagaccact
gcaatgttccggccctttgtggaagtttgtattctgggacctaacctaggagacaaaaag
agaaaacaaggcacgaagacaaaaagcaacacatggtcaccaaagtacaatgaaacattt
caattcattctgggtaatgaaaaccggccaggggcctatgaacttcatctctcagttaaa
gattactgctttgccagagaagatcgaattatcggaatgacggtaattcaactacagaac
atagcagaaaagggaagctatggatcatggtatccccttctgaaaaatgtctccatggat
gaaactggtttgactatccttagaatactctctcagaggaccagcgatgacgtggctaaa
gaatttgtaagactgaaatctgaaacgagatctgctgaagagagcgcttga

DBGET integrated database retrieval system