KEGG   Ailuropoda melanoleuca (giant panda): 100473360Help
Entry
100473360         CDS       T01329                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:aml03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 786 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKAAEYRGSEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKNLFNIISRKK
EALKEETNQKDKGNCKEDCLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVVELSTKVEEKPHQK
EEMNGINSIEMDNLRHSEDYKEKLQKGNGKRKSDIEFGNMKKKVKLSKEHQSLEENQRQT
RSKRKATGGDTLEIPSKIIPKYVSENESARPSQKKSRVKINWLKPATKQPSILSKFCSLG
KITTNQGSKGQSKENEYDLEEDLGKCENHNTTNGCELESPGNNVKPVNVNEVKPINKGAE
QIGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPK
TEMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASG
LEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVK
VTDLHSLELDKGNFVIDQMCEIGKPEPLNEEEARGVVENYDDEEVSIRVSGNTQPSKVLN
KKNAEAIGLLGGQKSKADYELYNKASNPDKVASTAFVENRNSETNNTNGTHEFDTNKESS
DQAGINFSGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYL
LFYKKL
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagtgaaagtaatgggctttcaagaggtagcccatcaaagaaa
aacagactttccttgaagttttttcagaaaaaggaaactaagagagccttggatttcaca
gattctcaagaaaacgaagaaaaggctgctgaatatagaggatctgaaattgatcaagtt
gttcctgcagcacagtcctcacctataaactgtgagaagagagaaaatttgttaccattt
gtgggactgaataatctcggcaatacttgttatcttaatagtatacttcaggtattatat
ttttgtcctggttttaaatctggagtgaagaacttatttaatattatttcaaggaagaaa
gaagccctaaaagaggaaaccaatcaaaaagataagggaaattgcaaagaagattgtttg
gcaagttatgaactaatatgcagtttacagtccttgatcatttcagttgaacagcttcag
gctagctttctcttaaatccagagaaatacactgatgaacttgctactcagccaaggcga
ctgcttaacacactcagggaactcaaccctatgtatgaaggatatctacagcatgatgca
caggaagtattacagtgtattttgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaagtaaaaaatgtggtagaattatccactaaggtagaagaaaaacctcatcagaaa
gaggaaatgaatggtattaacagcatagagatggacaatctgaggcattctgaagattat
aaagaaaaactccaaaaaggaaatgggaaaagaaaaagtgacattgaatttggtaacatg
aagaaaaaagttaaattatccaaggaacaccagtcattggaagagaaccagagacaaacc
agatcaaaaagaaaagctacaggtggtgatacgttagagattccttctaaaataatcccc
aagtatgtttctgaaaatgaaagtgcaagaccctcacaaaagaaatcaagagttaaaata
aattggttaaagcctgcaactaagcaacccagcattctttctaaattctgtagtctgggg
aaaataacaacaaaccagggatccaaaggacagtcgaaagaaaatgaatatgatcttgaa
gaggacttggggaagtgtgaaaatcataacacaactaatggttgtgaacttgagtctcca
gggaataatgttaagcccgttaatgttaatgaagttaagcccataaacaaaggtgcagag
caaattggttttgagctagtagagaaattatttcaaggtcagctggtattaaggactcgt
tgcttagaatgtgaaagtctaacagaaagaagagaagattttcaggacatcagtgtacca
gtacaagaagatgagctttccaaagtagaggagagttctgaaatttctccagagccaaaa
acagaaatgaagaccctgagatgggcaatttcacagtttgcttcagtggagaggattgta
ggagaagataaatatttctgtgaaaattgccatcattatactgaagctgaacgaagtctt
ttgtttgacaaaatgcctgaagttataactattcatttgaagtgctttgctgctagtggc
ttggagtttgattgttatggtggtggactttccaagatcaacactcctttactgacacct
cttaaattgtcactagaagaatggagcacaaagccaaccaacgacagctatggattattt
gcggttgtgatgcacagtggcattaccatcagtagtgggcattacactgcttctgttaaa
gtcaccgaccttcacagtttagaactagataagggaaattttgtgatcgaccaaatgtgt
gaaataggtaagccagaaccattgaatgaggaggaagcaaggggtgtggttgaaaattat
gatgatgaagaagtgtcaattagagtaagtggaaatacacagccaagtaaagttttgaac
aaaaaaaatgcagaagctattggacttcttggaggacaaaagagcaaagcggattatgag
ctatacaacaaagcatctaatcccgataaagttgccagtacagcatttgttgaaaataga
aattctgagactaacaatactaatgggacccatgaatttgatacaaacaaggaatccagt
gaccaagcaggcattaactttagtggatttgagaacaaaatttcatatgtagtacaaagc
ctaaaggagtatgaggggaagtggttactttttgatgattctgaagtgaaagttacagaa
gagaaggactttttgaattctctttccccttctacatctcctacatctactccttatttg
ctgttttataagaagttatag

DBGET integrated database retrieval system