KEGG   Ailuropoda melanoleuca (giant panda): 100473628Help
Entry
100473628         CDS       T01329                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100473628
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP4 family
   100473628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 514 aa AA seqDB search
MLSVLLSLSVSRLGLWAAGLILVLGLLKLIRLLLRRQMLARAMDSFPGPPTHWLFGHAQE
IQQTGSLDKVVSWAHQFPYAHPLWLGQFLGFLNIYEPDYAKAVYSRGDPKAADLYDFFLQ
WIGKGLLVLQGPKWYEHRKLLTPGFHYDVLKPYVAVFTNSTHTMLDQWEEKAREDKSFDI
FCDVGHMALDSLMKCTFGKGDSGLDHRDSSYHSAVRDLTLLMQERIDSFQYHNDFVYWLT
PHGHRFLRACQAAHDHTDHVIRGRKAALKDEKEWEKIQSRRHLDFLDILLGARDENGIKL
SDEDLRAEVDTFMFEGHDTTTSGICWFLYCMALYPEHQHRCREEVCEILGDRDSFQWDDL
GKMTYLTMCIKESFRLYPPVPQVYRQLSKPVSFVDGRSLPAGSLISLHIYALHRNSAVWP
DPEVFDPLRFSPENVATRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFALDP
LRPPIKMPQLVLRSKNGIHLHLKSLRPDSGKQLC
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgctttctgtcttgctctccttgagtgtctcccgtctgggcctgtgggctgctggattg
atcttggtcttaggcctcctcaagctcatccgtctgctgctgcggaggcagatgctggcc
agagctatggacagtttcccagggccccccacccactggctcttcgggcacgcccaggag
atccagcagacagggagcctggacaaggtggtgtcctgggcccaccagttcccttatgcc
cacccactctggcttggacagttccttggcttcctgaacatctatgagcccgactatgcc
aaagctgtgtacagccgaggggaccctaaggctgcagatttgtatgacttcttcctccag
tggattgggaaaggcctcctggtgctccaggggcctaagtggtatgagcaccgcaagctg
ctcacccctggcttccactatgatgtgctaaaaccctatgtggctgtgttcaccaactcc
acgcacactatgctggaccagtgggaggaaaaggctcgtgaggataagagctttgacatc
ttctgtgatgtgggccatatggcactggactcactcatgaagtgcacctttggcaaagga
gacagcggtctggaccacagggacagtagctaccactcggccgtcagagacctcactctg
ctgatgcaggagcgcattgattccttccagtaccataatgacttcgtctattggctcacc
ccacatggccaccgcttcctgagggcctgccaggcagcccacgaccacacagaccacgtc
atcaggggacgaaaggcagccctgaaggatgagaaagagtgggagaagatccagagccgg
aggcacctggacttcctggacattcttctgggggctcgggatgaaaatggtatcaaattg
tcagacgaagatctccgggctgaggtggacacgttcatgtttgaaggccatgacaccacc
accagtggcatctgctggtttctctactgcatggccctgtaccctgagcaccagcatcgc
tgtcgggaggaggtctgcgagatccttggggaccgggactccttccagtgggatgatctg
gggaagatgacctatttgaccatgtgcatcaaggagagcttccgcctctacccacctgtg
ccccaggtataccgccagctcagcaagcctgtcagctttgtggatggccgctccctacct
gcaggcagcctcatttctctgcacatctatgccctccataggaacagcgcagtgtggcct
gaccctgaggtctttgaccctctgcgtttttcccctgagaatgtggccacacgtcacccc
ttcgccttcatgcccttctctgctgggcccaggaactgcatcgggcagcagtttgccatg
aatgagatgaaggtggtcacagccctctgcttgctccgctttgagttcgccctggacccc
ttgcggccccccatcaagatgccccagctggttctgcggtccaagaatggcatccatctc
cacctgaagtcgctgcgcccagactctgggaagcagctctgctga

DBGET integrated database retrieval system