KEGG   Ailuropoda melanoleuca (giant panda): 100473675Help
Entry
100473675         CDS       T01329                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1 (pore forming protein)
  KO
K07818  
perforin 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100473675 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100473675 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100473675 (PRF1)
   05330 Allograft rejection
    100473675 (PRF1)
   05332 Graft-versus-host disease
    100473675 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    100473675 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100473675 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 554 aa AA seqDB search
MGARLFLPGLLLLLPTPTPAPCRTATRNECRSNRVFVPGTALAGEGVDVTTLKRSGSFPV
DTESFLRPDGTCTLCQNALQEDALQRLPLALTGWRAQGSGCQRQVVRAKASSTEGVAREA
ASNIRNDWRVGLDVSPKPSVNVQVTVAGSHSKMANFAAHKTHQDQYRFTTDLVECRFYSF
HLVHSPPLHPNFQRALSDLPPNFNTSTEADYLRLISSYGTHFIRSMELGGQISALTALRT
CELALDGLTASEVEDCLAVEAQVSISGRASSSSEFKACEEKKQQHKMETSFHQSYQERFS
QIVGGHHTSMGDLLFGTQAGPEQFSAWMNSLLDRPGLVDYTLEPLHVLVESKDPRREALR
QAVSKYVMDRARWKDCSRPCPPGQRKSPHNPCQCVCHSSATTNQDCCPRQRGLARLEVMN
FQATGLWGDNFTPTDAYLKVFFGGQELRTNTVWNNNHPKWMTRLDFGDVLLSMGGPLRVQ
VWDQDNGWDDDLLGTCDQKAQTGSHEVRCHLNHGHLRFSYQAKCLPHLEGPTCLQYAPHG
LLGAPPGNRSGPVW
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcccgcctgttcctcccgggcctcctcctgctgctgcccacgcccaccccggcg
ccctgccgcacggccacccgcaatgagtgccggagcaaccgcgtgttcgtacccggcaca
gcgctggccggggagggcgtggacgtgaccaccctcaagcgctcgggctccttcccggtg
gacacagagagcttcctgcgccccgatggcacctgcaccctctgccagaatgccctgcag
gaggacgccctccaacgcctgcccctggcactgaccggctggcgcgcccagggctcaggc
tgccagcgccaagtggtcagggccaaggccagctccaccgaaggcgtggccagggaggcg
gccagcaacatccgcaacgactggcgggtggggctggatgtgtctcccaaacccagcgtc
aatgtgcaggtgaccgtggctggctcgcactccaagatggccaacttcgctgcccacaag
acccaccaggaccagtatcggttcaccactgacttggtggagtgtcgcttctacagtttt
cacctggtacactctcccccgctccaccccaacttccagagggccctcagcgacctgccc
cccaacttcaacacctccacagaggctgactacctcaggctcatctccagctacggcacc
cacttcatccggtccatggagctgggaggccagatctcggccctcactgccctgcgcacc
tgtgagctggccctggacgggctcacggccagcgaggtggaggactgcctggccgtcgag
gcccaggtcagcataagcggccgcgccagctcttcatcagaattcaaggcctgtgaggag
aagaagcagcagcacaagatggagacctccttccaccagtcctaccaggaacgcttttcc
caaatagttgggggccaccacacctccatgggcgacctgctgtttgggacacaggccggg
ccggagcagttctcagcctggatgaactcactgctggacagacccggcctggtggactat
accctggagcccctgcacgtgctcgtggagagcaaagacccccggcgggaggcgctgagg
caggccgtgagcaagtacgtgatggaccgggcccgctggaaggactgcagcaggccctgc
cccccggggcagcggaagagcccccacaacccatgccagtgcgtgtgccacagctcggca
accaccaaccaggactgctgcccccggcagaggggcctggcccgcttggaggttatgaac
ttccaggcgacaggcctgtggggagacaacttcacccccacagacgcctatctgaaagtc
ttctttggaggccaggagctgagaaccaacacggtgtggaacaataaccaccccaagtgg
atgacgcggctggacttcggggacgtgctcctgtccatgggggggcccctgagggtgcag
gtctgggaccaagacaatggctgggacgatgacctccttggcacctgtgaccagaaagca
cagactggctcccatgaggtgagatgccacctgaaccacggtcacctgagattctcctac
caggccaagtgcttgcctcacctggaggggcctacctgcctgcagtatgccccccacggt
cttttgggggcacctccaggaaaccggagcgggccagtgtggtga

DBGET integrated database retrieval system