KEGG   Ailuropoda melanoleuca (giant panda): 100473777Help
Entry
100473777         CDS       T01329                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100473777 (GLS)
   00330 Arginine and proline metabolism
    100473777 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100473777 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100473777 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    100473777 (GLS)
   04727 GABAergic synapse
    100473777 (GLS)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100473777 (GLS)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100473777 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 649 aa AA seqDB search
MMRLRGSAMLRDLLLRPPPASCAALRRAQPLATQCRRPRGGGQGAAVARGLSSSPSEILQ
ELGKGSPQQQQPGASPPAAPSAPGPKDGPGETDAFGSSEGKELVASGENKIKQGLLPSLE
DLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLF
KKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELFESAKKQSGGKVADYIPQLAKFSPDL
WGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNK
LFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQS
ERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFC
PITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMC
WSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFA
AYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWN
NTPMDEALHFGHHDVFKILQEYQGQYTPQGDSGNGKENQTVHKNLDGLL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgactgcgaggctcggcaatgctgcgggacctgctcctgcggcctccccccgcc
tcctgcgcggctctgaggcgggcacagcccctcgccacacagtgccggcgtccccgaggc
gggggacagggggccgcggtcgcgcggggactgtctagctccccctcggagatcctgcag
gagctgggcaaggggagcccgcagcagcagcaacccggggcgtcgccgcccgcggccccg
tcggctcccggccccaaggacggacccggggagacggacgcgttcggcagcagtgagggc
aaggagctggtggcctcaggcgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcagaaggacaagagaaaatacctgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagatcttttt
aaaaaatgcgttcagagcaatattgttttgttgacacaagcctttagaagaaagtttgtc
attcctgactttatgtcttttacttctcacattgatgagttatttgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcagctagccaagttcagtcctgatttg
tggggtgtgtctgtgtgtacagtagatggacagaggcattctattggagataccaaagtt
ccattttgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgatctt
ggaacagaatatgtgcatcgatatgttgggaaagagccaagtggattaagattcaacaaa
ctgtttttaaatgaagatgataagccacataatcctatggtaaatgctggagcaattgtc
gtgacttcattaataaagcaaggagtgaataatgctgaaaaatttgactatgtgatgcag
tttttgaataagatggctggcaatgaatatgttggattcagtaatgcaacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacctaaaagaaaaaaagtgt
tttccagagggcacagacatggttggtatattagacttctatttccagctatgctccatt
gaagtaacttgtgaatcagccagtgtaatggctgcaacactggctaatggtggtttctgt
ccaattactggtgagagagtactgagccctgaagcagttcgaaatacactgagtttgatg
cattcctgtggcatgtatgatttctcagggcagtttgctttccatgttggtcttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgtcatgggcatgatgtgc
tggtctcctcctctggacaagatgggcaacagtgttaagggaattcatttctgtcacgat
cttgtttctctctgtaatttccataactatgataatctgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtgaagtcagtgataaacctgttgtttgct
gcgtacactggagacgtgtctgcacttcgaagatttgctctgtcagccatggacatggaa
cagcgagactatgactctaggacagccctccatgtagctgctgcggagggtcatgttgaa
gttgtcaaatttttgctggaagcgtgcaaagtaaaccctttccccaaggacaggtggaat
aacacgcccatggacgaagcgctgcacttcggacaccacgatgtgtttaaaatcctccag
gagtaccaaggccagtacacgccccagggagattccggcaacggaaaagaaaatcaaacg
gtccataagaatcttgacggattgttataa

DBGET integrated database retrieval system