KEGG   Ailuropoda melanoleuca (giant panda): 100473787Help
Entry
100473787         CDS       T01329                                 

Definition
sphingosine kinase 1-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100473787
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100473787
   04020 Calcium signaling pathway
    100473787
   04071 Sphingolipid signaling pathway
    100473787
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100473787
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100473787
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100473787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 473 aa AA seqDB search
MSAQVLAFLRNCPPPPVSSPSDPAAAGDDSGASTAPAPGGEGEPLSRHRDARLGSTDKEL
KAGAAAAGSSATALGTPWQRVCGLPVGKGSGGAGSLLPRPCRVLVLLNPRGGKGKALQLF
RSHVQPLLVQADVSFTLMLTERRNHARELVRVEELGRWDALVVMSGDGLMHEVVNGLMER
PDWETAIRKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLAPMNLLS
LRTASGLRLFSVLSLAWGFIADVDLESEKFRRLGEMRFTLGTFLRLAALRVYQGTLAYLP
AERVVSQVPAPPAVERQDQQGPTDAHLVPLEEPVPPHWTVVPEQDFVLVLALLHSHLGSE
MFAAPMGRCAAGTMHLFYVRAGVSRAMLLRLFLAMEKGRHMDCDCPYLVYVPVVAFRLEP
KDGKGVFAVDGELMVSEAVQGQVHPDYVWMVSGCMEPPPSQKPQQGPPPGEPL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctcaagttctggcatttttacgcaactgcccccctccccctgtttcctctccc
tcagatcccgcagcggcaggggatgactcgggtgcctccacggccccggctccgggcggg
gagggcgagcccctcagccggcaccgcgacgcccgcctgggcagcaccgataaggagctg
aaggcaggagccgccgccgcgggcagctccgcgacagcgctggggacgccctggcagcgg
gtttgtggtctcccggtggggaagggctcgggcggcgccgggagcctgctgcccaggccc
tgccgcgtgctggttctgttaaacccgcgcggaggcaagggcaaggcgctgcagctcttc
cgcagccacgtgcagcctctgctggtccaagccgatgtctccttcacgctcatgctaact
gagcggcggaaccatgctcgggagctggtgcgggttgaggagctggggcgctgggatgcg
ctggtggtcatgtctggagacgggctgatgcatgaggtggtgaatgggctcatggagcgg
ccagactgggagactgccatccggaagcccctgtgtagcctcccagctggctctggcaat
gcactggcagcttctttgaaccattatgccggctacgagcaggtgactaatgaggacctc
ctgaccaactgcacactgctgctgtgtcgccggctgctggcgcccatgaacctgctgtca
ctgaggacggcctcggggctgcgcctcttctccgtgctgagcctggcttggggcttcatc
gctgacgtggatctggagagtgagaagtttcggcgtctaggggagatgcgcttcactctg
ggcaccttcctgcgcctggcggccctgcgagtctaccagggcacgctggcctacctccct
gcagaaagggtagtctcccaggtgcctgccccccctgccgtggagcgccaggaccagcag
ggtcccacggatgcccaccttgtacccctggaggagccggtgcccccgcactggactgtg
gtcccggagcaggacttcgtgctcgtgctggcgctgctgcactcccacctgggcagcgag
atgtttgcggcccccatgggccgatgtgcggccggcaccatgcatctcttctatgtgcgg
gcaggcgtgtctcgggccatgctgctgcgcctcttcctggccatggagaaggggaggcac
atggactgtgactgtccctacttggtgtacgtgcctgtggttgccttccgcctggagccc
aaggacgggaagggtgtgtttgctgtggatggcgagttgatggtcagcgaggctgtgcag
ggccaggtgcacccagactacgtctggatggtcagtggctgcatggagcccccacccagc
cagaagcctcagcagggaccacctccaggcgagcctttatga

DBGET integrated database retrieval system