KEGG   Ailuropoda melanoleuca (giant panda): 100473887Help
Entry
100473887         CDS       T01329                                 

Gene name
USP30
Definition
ubiquitin specific peptidase 30
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 517 aa AA seqDB search
MLSSRAQAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIKWLEEFTTQYTRDQKEAPSHQYLSLTL
LHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQ
PRVTHLFDVHSLEQQPEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQ
SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTQIEAKGTSNGEK
VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGAPLKRHEHVQFNEFLMMDIYKYHLLG
HKPGQHSPKPGEAGGPPDDLQDGPAAPSSVLNQPGGPKTQIFMNGACSPSLLPPLPAPLP
FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSAKNPLSTSNQWLWISDDT
VRKASLQEVLSSSAYLLFYERVLSKMQHQGREYRSEE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctcccgggctcaggcggcgatgaccgcggcggaccgggccatccagcgcttc
ctgcggaccggggcggccgtcagatataaagtcatgaagaactggggtgtcataggtgga
attgctgcagctcttgccgcgggaatctatgtgatttggggtcctatcacagaaagaaag
aagcgtagaaaaggactggtgcctggccttgtcaacttagggaacacctgcttcatgaac
tccctgctgcaaggtctgtctgcctgccctgctttcatcaagtggctggaagagtttacc
acgcaatacaccagggatcagaaggaggccccctcacaccagtatttatccttaacgctg
ttgcacctcctcaaagctctgtcctgccaagaagtcaccgacgatgaggtcttagatgca
agctgcttgttggatgtattaagaatgtacagatggcagatctcttcatttgaagaacag
gatgcccacgagttattccatgtcattacctcctccctggaagacgagcgggaccggcag
ccccgggtcacccatttgtttgatgtgcattccctggagcagcagccagaaataactccc
aaacaaataacctgccggacaagagggtcacctcaccccacgtccaatcactggaaatct
cagcatcctttccatggaaggctgacgagtaacatggtctgcaaacactgtgaacaccag
agtcctgttcgatttgataccttcgacagcctttcactgagtattccagctgccacgtgg
gggcatccactgaccctggaccactgccttcaccacttcatctcatccgaatccgtgcgg
gacgtcgtgtgtgacaactgtacgcagatcgaagccaaagggacgtcgaatggggagaag
gtggaacaccagaggaccacgttcgttaaacagctgaaactgggcaagctcccgcagtgt
ctctgcatccacctccagcgactgagctggtccagccacggcgcacccctgaagcgccac
gagcacgtgcagttcaacgagttcctgatgatggacatctacaagtatcacctcctcggc
cacaaacccggccagcacagccccaagcccggcgaggctggggggccccccgacgacctg
caggatgggccggccgcccccagttcagttctgaaccagcccgggggcccgaaaacacaa
atttttatgaatggcgcctgctccccatctttattgcccccgctgccggccccgctgccc
ttcccgctcccggtggttcctgactacagctcctccacgtacctcttccggctgatggca
gttgtggtccaccacggagacatgcactcggggcacttcgtgacgtaccgacggtcccca
ccgtcggccaagaaccctctttcaaccagcaaccagtggctgtggatctccgacgacacg
gtccgcaaggccagcctgcaggaggtcctgtcctccagcgcctacctgctgttttatgag
cgggttctttccaagatgcagcaccagggccgggagtacaggtccgaagaatga

DBGET integrated database retrieval system