KEGG   Ailuropoda melanoleuca (giant panda): 100473987Help
Entry
100473987         CDS       T01329                                 

Definition
epididymal secretory glutathione peroxidase-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100473987
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100473987
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100473987
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100473987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 221 aa AA seqDB search
MTARLRAAYLVPLLLVSVTQTNAKLEKMKMDCYKDVKGTIYEYEAFPLNGSEHVQFNQYT
GKHVLFVNVATYCGLTAQYPELNTLQEELKPLGLVVLGFPCNQFGKQEPGENSEILPGLK
YVRPGKGYVPNFQLFEKGDVNGEKEQKIFTFLKLSCPHPSEVLGSFKHISWDPVKVHDIR
WNFEKFLVGPDGVPVMRWFHRTPVSTVKSDILEYLKPFKSK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccggttgagggccgcctaccttgtacctcttctgctggtcagcgtcacgcag
acaaatgccaagcttgagaagatgaaaatggactgctacaaagatgtgaaaggcaccatc
tatgaatatgaagccttccctctgaatggaagcgaacacgttcagttcaatcagtacacg
ggcaagcacgttctttttgtcaacgtggccacctactgtggtctgacagctcagtatcct
gaactgaacacacttcaggaggagctgaagcccctgggcctggtggtgctgggctttccc
tgcaaccaatttggaaagcaggagccaggagagaactcagagatcctgccggggctgaag
tatgtccgtccagggaaaggatacgtacctaatttccagctttttgagaaaggggatgtg
aatggtgagaaagaacaaaagatcttcaccttcttgaagctctcctgcccacacccctct
gaggttctgggctcattcaaacacatatcctgggatcccgtaaaggtccacgacatccgc
tggaactttgagaagttcttggtggggcctgatggagtccctgtcatgcgctggtttcac
cggactcccgtcagcacggtcaagtcagacatcctggagtacctgaaaccgttcaaaagt
aaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system