KEGG   Ailuropoda melanoleuca (giant panda): 100474182Help
Entry
100474182         CDS       T01329                                 

Gene name
PTPRR
Definition
protein tyrosine phosphatase, receptor type, R
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100474182 (PTPRR)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100474182 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 654 aa AA seqDB search
MRTAVSFPALCLLLNLHAAGCFSGNNDQFLAIHQKRSGKPAFIYHHSQDIEKSLDIAPQK
INKHSYHSSPRAQINKRHQIGNSAFPRPAYDPSLNLLAMAGQDLEVENLPIPAANVIVVT
LQMDVNRLNITLLRIFRQGVAAALGVLPQQVHINRLIGKKNSVELFVSPTSRKAGASEAL
PSEEVLRSLNINVLHQSLSQFGIIEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKEKFQLSLRQDKEKNQEIHLSPVALPPAQSEAKAVSSMVQPEQALKVLD
VVVDPQGRHSPEIKATTSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAIPTP
REKVAMEYLQSASRILTRSQLRDIVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYK
TILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQ
EDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTVRNLVLKQGSHTQ
HVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASTGRGPVVVHCSAGIGRTGCFIATA
IGWGQKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgcggacagcagtcagcttccctgcgctgtgcctgcttcttaatcttcacgctgcaggg
tgcttttcaggaaataatgatcagttcttggcaattcatcagaagaggagtgggaagcca
gcattcatttatcaccattctcaagacattgagaagagcctggatatagctccacagaag
ataaataaacatagctaccattcctctcctagagcgcaaataaacaaacggcaccaaatt
ggtaattcagcatttccaagacctgcatatgacccatctctcaatctgctggccatggct
ggtcaagatcttgaagtggaaaaccttccaatccctgcagcaaatgtaattgtggtgaca
ctgcaaatggatgtgaacaggctgaacataaccttgcttcggatattccgccagggagtg
gctgcagctttaggagtcttaccccagcaagtgcacatcaaccgcctcattggaaagaag
aacagtgtcgaactcttcgtgtctcctacaagccgaaaagcaggggcttctgaggccctg
ccgtccgaggaggtgctgcgttcacttaatataaatgttttacatcaaagtttatcccaa
tttggaattatagaagtctcccctgagaaaaatgttctacaagggcagcatgaagcggac
aaaatctggagcaaagaaggattttatgctgttgtcatttttctcagcatctttgttatt
atagtaacgtgtttgatgattctttacagattaaaagaaaaatttcagctttccttgcga
caagataaagagaaaaaccaggagatccacctgtcacccgttgcgttaccaccagcacag
tccgaggcaaaggcagtcagcagcatggtgcagcccgagcaggctctaaaggtgctggat
gtggttgtggacccgcaaggccgacactctcctgagatcaaagccaccacctctgtctgc
ccgtctcccttcaaaatgaagcccataggacttcaggagagacgagggtccaacgtatct
cttacattggacatgagtagcttggggaatgtcgaaccctttgtggctatcccaacccca
cgggagaaggtagccatggagtatctgcagtcagccagccgaatactcacaagatcacag
ctgagggacatcgtggcaagttcacatttactccaaagtgaattcatggaaataccaatg
aatttcgtggatcccaaagaaattgacattccacgtcatggaactaaaaatcgctataag
accattttgccaaatcccctcagcagagtgtgtttaagaccaaaaaatgtaactgattct
ttgagcacctacattaatgctaattatattaggggctacagtggcaaagagaaagcattc
atcgccactcagggccccatgatcaacaccgtgaatgatttctggcagatggtttggcag
gaagacagtcccgtgattgtcatgatcacaaaactcaaagaaaaaaatgagaaatgtgtg
ctatactggccagaaaagagaggaatatatgggaaagtcgaggtcctggtcatcagtgta
aatgaatgtgacaactacactgttcgaaaccttgtcttaaagcaaggaagccacacccag
catgtgaaacattactggtacacctcatggcccgatcacaagaccccagacagtgctcag
cctcttctgcagctcatgctggacgtcgaagaagatagacttgcttccacgggccggggg
cctgtggttgtccactgcagtgcagggatcggtagaacgggatgctttattgctacagcc
attggctggggacagaaagaagaaggagttgtggatgcactaagcattgtctgccagctt
cgtgtagacaggggtggaatggtccagaccagcgagcagtatgaatttgtgcaccatgcc
ctgtgcctgtacgagagcagactctcggcagaaactgtccagtga

DBGET integrated database retrieval system