KEGG   Ailuropoda melanoleuca (giant panda): 100474237Help
Entry
100474237         CDS       T01329                                 

Gene name
ASH1L
Definition
ash1 (absent, small, or homeotic)-like (Drosophila)
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysine degradation
Tight junction
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aml00310]
Cellular Processes; Cell communication; Tight junction [PATH:aml04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2965 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSALGTGTVVSKREGELENSTKEEEDLRKWNRERSSEA
GKEDGVTGAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKTGDVAAVECQSEESIHLHSQGENSPLSKKLSP
VHSEMTDYINAASSTLVGGRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
GTGTTAGLVSKDLIRKAGVGSVAGIIHKDLIKKPAISTAVGLVTKDPGKKSVFNATVGLV
NKDSVKKLGAGTTAVFINKDLGRKPGTVTTVGLLSKDSGKKLGIGIVPGLVNKESGKKLG
LGTVVGLVNKDLGKKLSSTVGLVAKDCAKKIVANSTMGLVTKDMGKKLVSCSMAGLVSKD
AINLKAEALLPTQEPLKASCSTNISSHESQELPEPLKDSTTSKTFEKSVIRQSKESILEK
FSVRKEIINLEKEMFNEGSCIQQDSFSSSDRGPYETSKHEKQPPVYCTSPDFQMGAASDA
SAAKSPFSAVGESNLPSPSPTVSVNPLSRSPPETSSQLAPNPLLLSPTTELMEEISESVG
KNQFTSESTHLNIGHRSVGLSMNIECKGIDKELTDSKTTHIDIPRISSSLGKKPSLTSES
SIHAVTPSVVNFTSLFSNKPFLKLGAVTASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVPCSSLSNSNSEPAKFMKNIGPSSFVDHDFLKRRLP
KLSKSAAPSLALLTDSEKPSHKAFATHKLSSSMCVSSDLLSDIYKPKRGRPKAKEMPQLE
GPPKRTLKIPASKVFSLQSKEEQEPPVLQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPNKLESESDTRRSSSDFFESEDQLQDPDDLDDSRRPTVCTMS
DLEMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPSLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHS
RQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSD
SGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
SYDKMKRQKRKRKKKYPQLRSRQDPDFIADLEELISRLSEIRITHRSHHFIPRDLLPTIF
RINFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYP
SYGMPYSPSPLPATPLGLGYYGRYPPTLYPPPPSPSFTPPLPPPSYMHAGHLLLNPTKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQV
SMDTGSSRSVLESLKRYRFGKETVGERYKHKEKHRCHMSCPHLSPSKSLINREEQWVHRE
PSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSDPASSDEHTNLFTSAIVQGSCRVAN
PNSSGRKKLTDSPGLFSAQDTSLTRPHRKEPLPSSERAVQTMTGSQPASEKSSQRPSEST
NCSPTRKRSSSESTSSTVNGVPSRSPRLLASGDDSVDSLLQRMVQHEDHEPLEKNIDAVI
ASATGPPSSSPGHSHSKERALGKPDSLLVPTAPTDSCSSSISLLSEKLPSSCSPHHIKRS
VVEAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPL
QAVVSMQAFQAARFVSPDLNEGEERTALPLRPDTVTDVIEAVVQSVNLSPEHKKGLKRKS
WLLEEQTKKKQKPFPEEEQEHTKSFTEAAVEIPSPPETPAKLPEPENTLQPVLSLIPREK
KAPRPPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVGKYLR
QKRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPEDD
TGKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEP
LKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHS
CDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGII
GGKSQRVNGLTSSKSSQPVATHKKSGRSKEKRKSKHKLKKRRGHLSEEPSENINTPTRLT
PQIQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNLHSASLYTRWNGICRDD
GNIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISYKDSSR
QALAAPLLNLPPKKKNADYYEKISEPLDLATIERQILTGHYKTVEAFDADMLKVFRNAEK
YYGRKSPIGRDVCRLRKTYYNARHEASAQIDEIVGETASEADSSETSVSEKENMHEKDDD
VIRCVCGLHKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMIPRPH
YAQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLDIFRI
EKLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVLDL
YTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKRDF
SPHYVPDNYKRNGGRSSWKSERPKPPLKDLGQEDDALPLIEEVLASQEQAADELPSLEEP
EREGAPAEVGESEKKPEESGQGSQPASTPEERRHSQRERLNQILLSLLEKIPGKNAIDVT
YLLEEGSGRKLRRRTLFIPENSFRK
NT seq 8898 nt NT seq  +upstreamnt  +downstreamnt
atggaccctagaaatactgctatgttaggattgggttctgactctgaagggttttcaagg
aagagtccctctgccctcggtactggcacggtggtcagcaagagagaaggagagctagag
aacagcacgaaagaggaagaggaccttcgcaagtggaatcgggagagaagcagtgaagca
gggaaggaggatggtgtgactggtgcacagcagcagttttcagtgaaagaaactaacttt
tcagagggaaacttaaaattgaaaattggccttcaggctaagagaactaaaaaacctcca
aagaacttggagaactatgtatgtcgacctgccataaaaacaactatcaagcacccaagg
aaagcacttaaaagtgggaagatgacagatgagaagaatgagcactgtccttcaaaacgg
gacccttcaaagttgtacaagaaaacaggtgatgttgcagccgttgaatgccagtctgaa
gagagcatccatcttcattcacagggagaaaacagtcctttgtctaagaagctttctcca
gtgcactcagaaatgacagattacattaatgcggcatcatctactcttgttggtggccgg
gatcctgatttaaaggacagagcattacttaatggaggaactagtgtgacagaaaagttg
gcacagctcattgcaacttgtcctccctctaagtcttccaagactaaaccgaagaagtta
ggaactggcactactgcgggattggttagcaaggatttgatcaggaaagcaggtgttggc
tctgtagctggaataatacataaggacttaataaaaaaaccagctatcagcacagcagtt
ggattggtaactaaagatcctgggaaaaagtcagtgtttaatgcaacagtaggattggtc
aataaggactctgtgaaaaaactaggagctggcactacagcagtattcattaataaagac
ttaggcagaaagccagggactgtcactacagtaggactgctgagcaaggattcaggaaag
aagctaggaattggtattgttccaggtttagtgaataaggaatctggaaagaagttagga
cttggcactgtggttggactggttaataaagacttgggcaagaagttgagttctactgtc
ggcctggtggccaaggactgtgcaaagaagattgtagccaattcaacaatgggattagtt
actaaggacatgggaaagaaactagtgagttgttctatggcgggactggtcagtaaagat
gccataaaccttaaagccgaagcactgctccctactcaggaaccactaaaggcttcttgt
agtacaaacatcagtagtcatgaaagtcaggaacttcctgaacccctgaaagatagtacc
accagcaaaacttttgagaagagtgttatacggcagagtaaagaaagcatattggaaaag
ttctcagttcgaaaagaaatcattaatttggagaaagaaatgtttaatgaaggatcgtgc
attcagcaggacagtttctcatccagtgacagggggccttatgaaacctcaaagcatgaa
aagcaacctcccgtgtattgcacttctccggactttcaaatgggagctgcttctgatgca
tctgcagcaaaatccccttttagtgcagtaggagaaagcaatctcccttccccatcacct
actgtatctgttaatcctttaagcagaagtccccctgaaacttcttcacagttggcccct
aatccgttacttttaagtcctaccacagaattaatggaagaaatttctgaatctgttggg
aagaaccagtttacttctgaaagtacccatttgaacattggtcataggtctgtgggtctc
agcatgaatattgaatgtaaagggattgataaagagctaactgattcaaaaactacacat
atagatattccaagaataagctcttccctgggaaaaaagccaagtttgacttctgaatcc
agtattcacgcagttaccccttcagttgttaacttcactagtttatttagtaacaagccc
tttctaaaacttggtgcagtcactgcgtctgacaaacactgccaggttgctgaaagccta
agcactagtttgcagtccaaaccattaaaaaaaaggaaaggaagaaaacctcggtggact
aaagtggtggcaagaagcacatgccggtctccaaaagggctagaattagaaagatcagag
ctttttaaaaatgttccatgtagctcactatcaaatagtaattctgagccagccaagttt
atgaaaaacattggaccatcttcgtttgtagatcatgacttccttaaacgtcgattgcca
aagttgagcaagtccgcagctccatctcttgctctcttaactgatagtgaaaaaccctct
cacaaggcttttgctactcacaaactatcttccagtatgtgtgtctctagtgacctgttg
tctgatatttacaagcccaaaagaggaagacctaaagctaaggagatgcctcaactggaa
ggtccacctaaaaggactttaaaaatccctgcctctaaagttttttctttgcagtctaag
gaagaacaggaacccccagttttacagccagaaattgaaattccttccttcaaacaaagc
ctttctgtgtctccttttccaaaaaagcgaggcagacctaagaggcagatgaggtcaccg
gtcaagatgaagccacctgtactgtcagtggctccgtttgttgccaccgagagtccaaac
aagctagagtctgaaagtgacacccgtcgaagcagcagtgatttctttgagagtgaggat
cagcttcaggacccagacgatctggacgacagtcgtaggccaactgtctgcaccatgagt
gaccttgagatggaaccagataaaaaaattaccaagagaaacaatggacaattaatgaaa
acaattatccgcaaaataaataaaatgaagactttaaagaggaagaagctgttgaatcag
attctttccagctctgtagaatcaagtaataaagggaaagtgcaatccaaactccacaac
acagtgtcgagtcttgcggccacgtttggctctaaattgggccaacagataaatgtcagc
aagaaaggaaccatttacataggaaagagaaggggtcgaaaaccaaaaactgttttaaat
ggcattctttctggtagccctaccagccttgctgtccttgagcaaaccgctcagcaggcg
gctggctcagcattaggacagatccttccctctttactgccttcgtctgctagtagttct
gagattcttccgtcacctatttgctctcagtcttctgggactagtggaggtcagagccct
gtaagtagtgacgcaggctttgttgaacccagttcagtgccatatttgcatttacactcc
agacagggcagcatgattcagactcttgcaatgaagaaagcctcaaaggggaggaggcga
ctctctcctcctactttgttgccaaattctccttcacacttgagtgaactcacctctctg
aaagaagctactccttctcccattagtgagtctcacagtgatgagaccattcccagtgat
agtggaattggaacagataacaacagcacatcagacagagcagagaaattttgtggacag
aaaaagaggaggcattcttttgaacacgtttctctgattccccctgaaacctctacagtc
ctgagcagtcttaaagaaaaacataaacataaatgtaagcgcaggaatcacgattacctc
agctacgacaagatgaaaaggcagaaacgaaaacggaaaaagaaatacccccagctccga
agcagacaggatccggacttcattgcagatctggaggaattgataagtcgtctgagcgaa
attcgaatcacccatcgaagtcatcattttatcccccgagacctgctgccaactattttt
cgaatcaactttaatagtttctatacacatccttctttccccttagaccctttgcactac
attcgaaaacccgacttaaaaaagaagagagggagacctcctaagatgagggaggcaatg
gcggagatgcccttcatgcatagcctcagttttcctctttctagtactggattctatcct
tcctatggcatgccttattctccctcaccccttccagccactcccctaggattaggttac
tatggaaggtaccctcccactctctatcctcctcctccttctccttctttcaccccccca
cttccacctccttcctatatgcatgctggtcatttacttctcaatcccaccaaataccat
aagaaaaagcataaactacttcgacaggaggcctttctcacaaccagcaggactcccctc
ctttccatgagtacctaccctagcgttcctcctgagatggcctatggttggatggtcgag
cacaaacataggcaccgtcacaagcacagagaacaccgttcttctgagcaaccccaggtt
tccatggacactggctcttccagatctgttttggagtctttgaaacgctatcgatttgga
aaggaaactgttggagagcgatataaacataaggaaaagcaccgatgtcatatgtcctgc
cctcatctctctccttccaaaagcttaataaatagagaagagcagtgggtccaccgagag
ccttcagaatctagtccattggctttgggattgcaaacacctttacagattgactgttca
gaaagttctccaagtttatcccttggaggattcactcccaactctgatcctgccagcagt
gatgaacacacaaaccttttcacaagtgcaatagtgcaaggcagctgcagagtcgcaaac
cctaactccagtggccggaagaaattaactgacagtcctggactgttttccgcacaggac
acgtcactaactcggcctcacagaaaggagccactgccttccagcgaaagggcagtacag
accatgacaggttcccagccagcctcagagaagtcttcccagcgaccatcagagagcaca
aactgtagccctacccggaagaggtcatcatctgagagtacttcatcaacagtaaacgga
gttccctctcgaagtccaagattgcttgcttctggggatgactctgtggatagtctgctg
cagcggatggtccaacatgaggaccatgagcccctggagaagaatatagatgctgtgatt
gcatctgccacagggccaccttcctccagtccaggccacagccacagcaaggagcgagcc
ctgggaaaaccagacagcctcctggtgcccacagcccccactgactcttgcagtagcagc
atctcactcctgtctgagaagttgccgagcagctgctcaccccaccatatcaagagaagt
gttgtggaagccatgcagcgccaagctcggaaaatgtgcaattatgacaaaatcttggcc
actaagaaaaacctggaccatgtcaataaaatattaaaagccaaaaaactccagagacag
gccaggacagggaataactttgtgaaacgcagaccggggcgacctcggaaatgccccctc
caggctgtggtgtcaatgcaagcattccaggctgcccggtttgtcagccccgacttgaat
gaaggcgaagaaagaacagcgctgcccctccgtcccgacacagttacggatgtcattgag
gctgttgtgcagagcgtaaacctgagtccagaacataagaaagggctgaagaggaaaagt
tggctgttggaagaacagaccaagaaaaagcagaagccattcccagaggaagagcaagag
catactaagagctttactgaagcagcagttgagattcccagtcctcctgaaaccccagcc
aagcttcccgaacctgaaaataccttgcagcctgtgctttctctcatcccaagggaaaag
aaggccccacgtcccccaaagaagaagtatcagaaagcagggctgtattctgacgtttac
aaaactacagacccaaagagccgattgatccaattaaagaaagagaagctggaatacact
ccaggagagcacgagtatggattgttcccagcccccattcatgttgggaagtatctgagg
caaaagagaattgacttccagcttccctatgacatcctttggcagtggaaacacaatcag
ctatacaaaaagccagatgtcccactgtataaaaaaatccgttcaaatgtctatgttgat
gtcaagcccctttctgggtacgaggccaccacctgtaactgtaagaagccagaagatgac
accgggaagggctgtgtggacgactgcctcaacagaatgatctttgctgagtgttccccc
aacacttgcccctgtggtgagcagtgctgtaaccagaggatacaaaggcatgagtgggtg
cagtgtctagaacgatttcgagctgaggagaaaggttggggaatcagaaccaaagaaccc
ctgaaagctgggcagttcatcattgaatacctaggggaggttgtcagcgagcaggagttc
aggaataggatgatcgagcagtatcataatcacagtgaccactattgcctgaacctggat
agtgggatggtgatcgacagttaccggatggggaatgaggcccgattcatcaaccacagc
tgtgacccaaactgtgaaatgcagaaatggtctgtcaatggagtgtaccggattggactg
tatgctcttaaagatatgccagctggtaccgagctcacttacgattacaacttccattcc
tttaatgtagaaaaacagcaattgtgtaagtgtggctttgagaaatgtcgaggaatcatc
ggaggcaagagtcagcgtgtgaatggactcaccagcagcaagagcagccagcctgtggct
acacataaaaagtccggacggtcaaaagagaagagaaagtccaagcacaagctgaagaaa
aggagaggccacctctccgaagaacccagtgaaaacatcaacaccccaacaaggttgacg
ccccaaatacaaatgaagccgatgtctaatcgagagaggaactttgtgttaaagcatcat
gtattcttggtccgaaactgggagaagattcggcagaaacaagaggaagtaaagcacacc
agcgataatctccactcagcatcgttatatacccgctggaatggcatctgccgagatgat
gggaacattaagtctgacgtcttcatgacccagttctccgccctgcagacagcacggtcg
gttcgaacaagacggctggcagcagcagaggaaaacattgaggtggcgcgggcagcccgc
ctcgcccaaatcttcaaagagatctgtgatggcatcatctcctacaaagattcttcccga
caagctctggcagcaccccttttgaacctccccccaaagaaaaagaatgctgattactac
gagaagatctccgagcccctggacctggccaccatagagaggcagatccttaccggccat
tacaagactgtggaggcctttgatgctgacatgctcaaggtgtttcggaatgctgagaag
tactatgggcgtaaatccccaattgggagagacgtttgccgcctacggaagacctactac
aatgccaggcacgaggcatcagcccagattgatgaaattgtgggagagacagcaagtgag
gccgacagcagcgagacgtctgtctccgagaaggagaacatgcacgagaaggacgacgat
gtgatccgctgtgtctgcggcctgcacaaggatgaaggcctcatgatccagtgcgacaag
tgcatggtgtggcagcactgtgactgtatgggggtgaactcggacgtggagcactacctt
tgtgagcagtgcgacccgaggcctgtggacagagaggtacccatgattcctcggccccac
tatgcccagcccggctgtgtctacttcatctgtttgctccgagatgacttgttgcttcgt
caaggcgactgtgtatacctgatgcgggatagccggcgcacacctgatggccacccagtc
cgccagtcctaccgactgttgtcacacattaaccgagacaaactggacatcttccgcatt
gagaagctttggaagaatgaaaaagaggaacgttttgccttcggtcatcactacttccgc
ccccacgagacccaccactcaccatcccgccgtttctatcacaatgagctgtttcgggtg
ccactctacgagatcattcccttggaggctgtggtggggacctgctgtgtcctggacctt
tatacgtattgtaaagggagacccaaaggagtgaaggagcaagatgtgtacatctgtgac
taccggctggacaagtccgcacacctgttctacaagatccaccggaaccgctaccctgtc
tgcaccaagccctacgccttcgaccacttccccaagaagctcacgcccaaaagagatttc
tcacctcattacgtcccagacaactacaagaggaacggagggcggtcatcctggaagtcc
gagcgcccaaagccacccctaaaagacctaggccaggaggatgatgctctgcccttgatt
gaagaggttctggccagccaggaacaggccgccgacgagctgcccagcctggaggagccg
gaacgggagggggcccctgctgaagtgggcgagagtgagaagaagccagaggagagtggt
caggggtctcagccggcctctacccctgaggagcggcggcacagccagcgggaacgactc
aaccagatcttactcagtctccttgaaaagatccctgggaaaaatgccatcgacgtgacc
tatttgctggaggaggggtcaggcaggaagctgcgaaggcgcactttgttcatcccagaa
aacagctttcggaagtga

DBGET integrated database retrieval system