KEGG   Ailuropoda melanoleuca (giant panda): 100474242Help
Entry
100474242         CDS       T01329                                 

Gene name
MRPS18B
Definition
(RefSeq) mitochondrial ribosomal protein S18B
  KO
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100474242 (MRPS18B)
Ribosome [BR:aml03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    100474242 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 258 aa AA seqDB search
MAASVFRWLLRRIPSLSPFRGAYGVQVPLQTLCTKGPPEEDSLPPVPITPYKNEPWKYLD
SEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKTCIRRDKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGVIFHAPYTGVCMKQHKKLTQAIQKARDHGLLSYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYGWKQPPERELSRLRRLYQGHLREESGPPPESMPEVLV
TSPAEASSTEQESPQNAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgtatttcgttggttgctcaggcgcattcctagcctttcgcccttcaga
ggtgcttacggagttcaggttcccctccagactctctgcaccaaaggcccccctgaggaa
gattctttgcccccagttcccataaccccttataagaatgaaccctggaaatatctggac
tcagaagaataccagaaccgctatggctctcgccccgtctgggctgactaccgtagaaac
cacaaaggtggaatacccccacagcggactcgaaagacatgtattcgtagagataaagtt
gctgggaatccctgccccatctgccgggatcacaagctgcatgtcgactttaggaacgtg
aagctcttggaacagtttgtctgcgcccacacaggtgtcatcttccatgccccatacaca
ggggtctgtatgaagcaacacaagaagttgacccaggccatccagaaagccagagatcat
ggtctcctcagttaccacattcctcaggttgaacctcgggaccttgacttcagtacctct
catggagctgtgagtgccactccgccagcccccaccctggtttcaggtgacccctggtat
ccatggtatggctggaaacagccaccagagagagagctgtcccgccttcgacggctctat
cagggccatctccgagaagagagtggtcccccacctgagtccatgcctgaggtgctcgtc
acatctccagctgaagcctcttccactgagcaggagagcccccagaatgctctgtag

DBGET integrated database retrieval system