KEGG   Ailuropoda melanoleuca (giant panda): 100474242Help
Entry
100474242         CDS       T01329                                 

Definition
28S ribosomal protein S18b, mitochondrial-like
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100474242
Ribosome [BR:aml03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100474242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 258 aa AA seqDB search
MAASVFRWLLRRIPSLSPFRGAYGVQVPLQTLCTKGPPEEDSLPPVPITPYKNEPWKYLD
SEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKTCIRRDKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGVIFHAPYTGVCMKQHKKLTQAIQKARDHGLLSYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYGWKQPPERELSRLRRLYQGHLREESGPPPESMPEVLV
TSPAEASSTEQESPQNAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgtatttcgttggttgctcaggcgcattcctagcctttcgcccttcaga
ggtgcttacggagttcaggttcccctccagactctctgcaccaaaggcccccctgaggaa
gattctttgcccccagttcccataaccccttataagaatgaaccctggaaatatctggac
tcagaagaataccagaaccgctatggctctcgccccgtctgggctgactaccgtagaaac
cacaaaggtggaatacccccacagcggactcgaaagacatgtattcgtagagataaagtt
gctgggaatccctgccccatctgccgggatcacaagctgcatgtcgactttaggaacgtg
aagctcttggaacagtttgtctgcgcccacacaggtgtcatcttccatgccccatacaca
ggggtctgtatgaagcaacacaagaagttgacccaggccatccagaaagccagagatcat
ggtctcctcagttaccacattcctcaggttgaacctcgggaccttgacttcagtacctct
catggagctgtgagtgccactccgccagcccccaccctggtttcaggtgacccctggtat
ccatggtatggctggaaacagccaccagagagagagctgtcccgccttcgacggctctat
cagggccatctccgagaagagagtggtcccccacctgagtccatgcctgaggtgctcgtc
acatctccagctgaagcctcttccactgagcaggagagcccccagaatgctctgtag

DBGET integrated database retrieval system