KEGG   Ailuropoda melanoleuca (giant panda): 100474359Help
Entry
100474359         CDS       T01329                                 

Definition
Josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100474359
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C86
   100474359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVSAIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGK
NCELLLVVPEEVEARQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggagacaaggccaaatctgaatctttggagctgccccag
gcagcacccccacaaatctaccatgagaaacagcgcagggagctttgtgccctgcatgcc
ctcaataacgtcttccaggacagcaatgccttcacccgggaaacgctgcaagagattttc
cagaggttgtctccaaacaccatggtgaccccccacaagaagagcatgctgggaaatggg
aactatgatgtgaacgtcattatggcagcacttcaaaccaaaggctatgaagctgtctgg
tgggacaagcgcagggatgtcagtgccattgctctcacgaatgtcatgggcttcatcatg
aatctgccctccagcctgtgctggggtccgctgaagttgcctctcaaaaggcagcactgg
atctgtgttcgagaggtgggaggtgcctactacaacctcgactccaaactgaagatgccc
gagtggattggaggcgagagcgagctcaggaaatttctcaaacatcacttgcgaggaaag
aactgtgaacttctgctggtggtgccagaagaggtggaggcccgtcagagttggagggct
gatgtgtaa

DBGET integrated database retrieval system