KEGG   Ailuropoda melanoleuca (giant panda): 100474367Help
Entry
100474367         CDS       T01329                                 

Gene name
AOX1
Definition
(RefSeq) aldehyde oxidase
  KO
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100474367 (AOX1)
   00350 Tyrosine metabolism
    100474367 (AOX1)
   00380 Tryptophan metabolism
    100474367 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100474367 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100474367 (AOX1)
   00830 Retinol metabolism
    100474367 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100474367 (AOX1)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100474367 (AOX1)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100474367 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 1315 aa AA seqDB search
MFWKSLKIFELRLTGTKYGCGTGGCGACTVMISRYNPTIKRISHHAANACLIPICSLYGA
AVTTIEGIGSTKARIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPSLEQLIDAL
GGNLCRCTGYRPIIDACKTFCKTSGCCQSRENGVCYLDQGINELPEFEEVNKISLKLFSE
EEFLPLDPTQELIFPPELMIMAEKQPQRTRIFGGDRMTWISPTTLTALLEAKFKYPQAPV
VMGNTSVGPEMKLKGVFHPVIISPDGIEELNFANCSHNELTLGAGLSLTQVQYILGEVIQ
NLPEEKTRMYCALLKHLTTLAGSQIRNMASLGGHIVSRHLDSDLNPLLAVGNCTLNLLSK
KGKRQVPLNEEFLRRCPSADLKPEEILISVKILHSRKWEFVSGFRQAQRQQNALAVVNSG
MRVFFGEGGDIIRELSISYGGVGPTTVCAKNSCRKLIGRPWNEEMLDAACRLVLDEVTLP
GSAPGGRVEFKRTLIVSFLFKFYLEVSQILKRMGPVRSPGLADKCKSAFEDLHSRHHCST
LKYEQNVDSKKHPQDPIGQPIMHLSGIKHATGEAIYCDDMPTVDRELFLSFVTSSRAHAK
IVSIDLSEALSLPGVVDIVTEEHLRGVNSFCILTEPEKLLRTEEVSCVGQLVCAVIAESE
VQAKQAAKRVKVVYQDLQPLILTIEEAIQHNSFFETERKLEYGNVDEAFKVVDHILEGEI
HIGGQEHFYMETQSMLVVPKGEDQEIDVYVSTQFPKYIQDIVASTLKLPANKVMCHVKRV
GGAFGGKTYKTGIMAAITAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDG
RILALDMQHYSNGGASLDESLLVIEMGLLKMENAYKFPNLRCRAWACRTNLPSNTALRGF
GFPQAGLITESCITEVAARCGLAPEKVRMINMYKEIDQTPYKQEINAKNLIQCWKECMDM
SSYSLRKAAVEKFNSENYWKKKGLAVVPLKFPVGLGSVAAGQAAALVHIYLDGSVLVTHG
GIEMGQGVHTKMIQVVSRELRLPMSSIHLRGTSTETVPNTNISGGSTVADLNGLAVKDAC
QTLLKRLEPIISKNPQGTWKDWAQAAFDESISLSATGYFRGYESNMSWETGEGHPFEYFV
YGAACSEVEIDCLTGAHKNIRTDMVMDVGCSINPALDIGQIEGAFTQGVGLYTVEELHYS
PQGVLYTRGPNQYKIPAICDMPTELHISLLPPSQSSNTLYSSKGLGESGIFLGCSVFFAI
HDAVNAARQERGLFGPLKLNSPLTPEKIRMACEDKFTKMIPKDKPGSYVPWNVPI
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atgttctggaagtcattaaagatctttgaacttcgactcacaggcactaagtatggctgt
ggaacgggaggctgtggtgcttgcacagtgatgatatcacgatataaccccactatcaag
aggataagccatcatgcagccaacgcctgcctgatccccatctgctctctgtacggggct
gctgtcaccacaatagaaggcataggaagcaccaaggccaggattcatcccgttcaggag
aggatcgccaagtgtcatggcacacagtgtgggttctgcacccctgggatggtgatgtcc
atctacacattgctgaggaaccatccagaaccttctctggagcagctaattgatgctctt
ggtggtaacctatgtcgttgcactggatataggcccataattgatgcatgcaagactttc
tgtaaaacttctggctgctgtcaaagtagagaaaatggggtttgctatttggatcaagga
ataaatgaattaccagaatttgaagaagtaaataagataagtctaaaactcttctcagaa
gaggagtttctgccattggatccaactcaagaattgatatttcctccagagctaatgata
atggctgagaaacaaccacaaaggactaggatttttggtggtgatagaatgacatggatt
tcaccaacgaccctgacggcacttctggaagctaaattcaagtatcctcaggcccctgtt
gtcatggggaacacctctgtagggcctgaaatgaaattaaagggtgtctttcacccagtt
ataatttctcctgatggaattgaagaactgaattttgcaaactgttcacataatgagctg
accttaggtgctggcctcagcctgactcaggtgcagtacatcttgggtgaagtaatccag
aacctcccagaggagaagacacggatgtactgtgctctcttgaagcatttgacaactctg
gctggatctcagatcaggaacatggcttctttagggggccatatcgtgagcaggcaccta
gattcagatctgaatcccctgctggctgtgggcaactgtaccctcaacttgctatcaaaa
aaaggaaaacgacaggttcctttaaatgaggagtttctcagaaggtgccccagcgcagat
ctgaagcctgaggagatcttgatctcagtgaaaatactccactcgaggaagtgggaattt
gtgtcaggctttcgacaagcccagcggcaacagaatgcactcgccgtagtcaattcggga
atgagagtcttttttggagaagggggtgacatcatcagagagttatccatctcatacgga
ggcgttggcccaaccactgtctgtgcaaagaattcctgccggaagctcatcggaaggccc
tggaatgaggagatgctggacgcagcttgcaggctggttctggatgaagttacccttcca
ggctcagctccgggtgggagggtggagttcaagaggactctcatcgtcagcttcctcttc
aagttctacctggaagtgtcgcagattctgaagaggatgggccctgttcgctctcctggc
cttgcagacaagtgtaagagtgctttcgaagatcttcattcccggcatcactgcagtacg
ttaaagtacgagcagaatgtagactcaaagaagcatcctcaagacccaattggccaaccc
atcatgcatctgtctggtattaagcatgccacgggtgaagccatctactgtgacgacatg
cctacagtggaccgggaacttttcttgtcctttgtgacaagttcaagagctcatgctaag
attgtgtctattgatttgtcagaagctctcagcctgcctggcgtggtggacattgtgact
gaggaacatcttcgtggtgtgaactccttctgcattttaaccgaaccggagaaacttctg
aggacagaggaggtgtcctgtgtgggccagcttgtctgtgctgtgatcgcagagtccgag
gttcaggcaaagcaagcggccaagcgagtgaaggttgtctaccaagatttgcagccactg
atcctgacaattgaggaagccatacagcacaactccttcttcgaaacagagaggaaactg
gaatatggaaatgtggatgaagcatttaaagtggttgatcacattctagaaggtgaaata
catataggaggtcaagaacatttttatatggaaacccaaagcatgcttgttgttcccaaa
ggagaggatcaagaaatcgatgtctatgtttctacacaatttcccaaatacatacaggac
atagttgcttcgaccttgaagctcccagctaacaaggtcatgtgtcacgtaaagcgtgtt
ggtggggcttttggagggaagacctataaaaccggcatcatggcagccatcaccgcattt
gccgccaacaaacatggtcgtgcagtccgctgcgttctggagagaggagaagacatgtta
atcactggaggccgccatccttaccttgggaagtacaaagctgggttcatgaacgatggc
agaatcttggccctggatatgcagcattatagcaatggaggcgcctccctggatgagtca
ttacttgtgatagaaatgggacttctgaagatggaaaatgcttacaagtttcccaacctg
cgctgccgggcgtgggcgtgcagaaccaaccttccatccaacacagctctgcgtggcttt
ggctttcctcaggcagggctcatcactgagtcctgtatcaccgaagtggcagccaggtgt
ggtttggcccctgagaaggtccgaatgataaacatgtacaaggaaattgatcaaacaccc
tacaaacaagagattaatgccaagaacctgattcagtgttggaaagaatgtatggacatg
tcttcctactccctgaggaaagcggctgtagaaaaattcaattcggagaattattggaag
aaaaaggggctggctgtggtccccctgaagtttcctgttggtttaggctcagtcgctgct
ggtcaggctgctgccttggttcacatttacctggatgggtctgtgctggtgacgcatggt
gggattgaaatgggtcagggcgtccacacgaaaatgattcaggtggttagtcgtgaatta
aggctgccgatgtctagcatccacctgcgtgggacaagcacagaaaccgtccctaacaca
aacatctctggagggtccacggtggcggatctcaacgggttggcagtaaaggatgcttgt
cagactcttctaaaacgccttgaacccatcatcagcaagaatcctcaaggcacttggaag
gattgggcacaagctgcttttgatgaaagcattagtctttcagctactggatacttcagg
ggctacgagtccaacatgagctgggagacaggcgaaggccatccttttgaatattttgtg
tatggagctgcctgttccgaggttgaaatagactgcctgacgggcgctcataagaacatc
agaacagacatggtcatggatgttggctgcagcataaatccagcccttgacataggccag
atcgaaggtgcatttactcaaggcgtggggctttatacagtagaggagctgcattattct
cctcagggtgtcctgtacactcgtggtccgaaccaatataaaatccctgccatctgtgac
atgcccaccgagctgcatatttctttattgcctccgtctcaaagctcaaataccctgtat
tcatcgaagggtctaggagagtctgggatattcctgggatgttcagtgttttttgccatt
catgatgcggtgaatgcagcacgacaggagagaggcctgtttggaccattgaagctcaat
agtcccctgactccagagaagattagaatggcctgtgaagataagttcacaaaaatgatc
ccaaaagacaaacctggatcctatgttccttggaatgtacccatatga

DBGET integrated database retrieval system