KEGG   Ailuropoda melanoleuca (giant panda): 100474458Help
Entry
100474458         CDS       T01329                                 

Definition
histone deacetylase 7-like
Orthology
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100474458
  Substance dependence
   05034 Alcoholism
    100474458
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100474458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 998 aa AA seqDB search
MSESLGDLDEEERAGECSHSAREFEGRNGADSLLFDGTQVSPGARCPSPPGTGRPRPRAD
TPGPQPQPMDLRVGQRPPVEPPPEPALLALQPPQRLHHHLFLAGLQPRPAESMRLPMDTP
VPQLQVGQQERELRQLLNKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPSIP
YRTLEPLETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRK
NPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEQGPNPVLGSEALLGQRL
RLQETSLAPFALPTVSLLPAITLGLPAPARADADRRTHPTLGPRGPVLGSPHAPLFLPHG
LEPEAGGPLPSRLQPILLLDPSVSHAPLLTDRPLSRTRSEPLPPSATAPPPLGPLQPRLE
RLKPHVQLIKRPAKPSEKPRLRQIPSAEDLETDGGGVGPVGDDGLEHRESSHGQHEARGP
VPLQQHQAPCVPQVFLWEQQRLAGRLPRGGTGDSVLLPLAQGSHRPLSRAQSSPAAPASL
PTPEPASQARVLPSSETPARTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSR
LQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFV
MLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHS
TAMGFCFFNSVAIACRQLQQQGKASKILIMDWDVHHGNGTQQTFYQDPGVLYISLHRHDD
GNFFPGSGAADEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRTVVMPIAREFSPDLV
LVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEA
CVAALLGNKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASRPDSWAPRAPG
ADTEEVEAVTALASLSVGILAEERPSEQLVEEEEPMTL
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagtcactgggtgacttggatgaggaagagagggctggcgagtgctctcattca
gcacgggaatttgaaggaaggaatggggcagactccttgctctttgatgggacccaggtg
agcccgggtgcccgctgccccagtccccctggcacaggccgccccaggccccgtgcagac
acgccaggccctcagccccagcccatggacctgcgcgtgggccagcggcccccggtggag
cccccgccagagcccgcgctgctggccctgcagcccccccagcgcctgcaccatcacctg
ttcctcgcgggcctgcagccgcgccctgcggagtccatgaggctcccgatggacacgccg
gtgccccagctgcaggtggggcagcaggagcgggagctgcggcagcttctcaacaaggac
aagagcaagcgaagtgccgtagccagcagcgtggtcaagcagaagctggcagaggtgatt
ctaaagaaacagcaggcagccctagagagaacagtccaccccaatagccccagcattccc
tacagaaccctcgagcccttggagacggaaggagctgctcgctctatgctcagcagcttt
ctgcctcctgttcccagcctgcccagtgaccccccagaacacttccctctccgaaagaca
gtctctgagcccaacctgaagctgcgttacaagcccaagaagtccctggagcggaggaag
aatccgctgctcagaaaggagagcgccccgcccagtctccggcggcggcccgcggagacc
cttggtgactcctccccgagtagcagcagcacgccagcctcgggctgcagttcccctaat
gacagcgagcagggccccaaccccgtcctgggctccgaggcgctcttgggccagcggctg
cggctgcaggagacctctctggccccgttcgccttgccgactgtgtccttgctgcccgca
atcacgctggggctacctgcccctgccagggctgatgctgaccgcaggacccatccgact
ctgggccctcgggggccggtcctggggagcccccatgctcccctcttcctgccccatggc
ctggagcctgaggctggaggccccttgccctctcgactacagcccatcctcctcttggat
ccctcagtttctcacgcccctctgctgactgaccggccactaagccggacccgctcagag
cccctgcccccaagcgccaccgcccccccaccgctgggccccctgcagccccgcctggaa
cggctcaaacctcacgtccagctgatcaagaggccagccaagccaagtgagaagccccga
ctgcggcagataccctccgctgaggacctagagacagatggcgggggtgtggggccagtg
ggggatgacggcctggaacacagggagtcaagccacgggcagcatgaggccagaggccct
gttcctctccagcagcaccaggccccctgtgtccctcaggtgttcctctgggagcagcag
cgactggctgggcggctcccccggggaggaactggggactctgtgctgcttcccctggcc
cagggcagtcaccggcccctatccagggctcagtcgtccccagccgcacctgcctcactg
ccaactccagagcccgccagtcaggcccgtgtcctgcccagctcggagacccctgccagg
accctgccattcaccacagggctggtctatgactcggtcatgctgaagcaccagtgctcc
tgcggggacaacagccggcaccccgagcacgcgggccgcatccagagcatctggtcccgg
ctgcaggagcgggggctccggagccagtgtgagtgtctccggggccggaaggcctccctg
gaggagctgcagtccgtgcactccgagcggcatgtgctcctctatggcaccaacccgctc
agccgcctcaaactggacaacgggaagctggcagggctcctggcacagcggatgtttgtg
atgctgccctgtggtggggtaggggtggataccgacaccatctggaacgagctgcactcc
tccaatgcagcccgctgggccgccggcagcgtcaccgacctcgccttcaaagtagcttcc
cgtgagctaaagaatggttttgctgtggttcggcccccaggacaccatgcagaccattcc
acagccatgggcttctgcttcttcaactcggtggccatcgcctgccggcagcttcaacag
cagggcaaggccagcaagatcctcatcatggactgggatgttcaccacggcaacggcacc
cagcagaccttctaccaggaccccggtgtgctgtacatctccctgcatcgccacgacgac
ggcaacttcttccccggcagtggggccgcggatgaggtgggagctggtagcggtgagggt
ttcaacgtcaacgtggcctgggcgggaggtctggaccctccgatgggggatcctgagtac
ctggccgccttcaggacggtcgtgatgcccatcgccagagagttctctccggacctggtc
ctggtgtcagctgggtttgatgctgccgagggtcacccagccccgctgggtggctaccat
gtttccgctaaatgtttcgggtacatgacgcagcagctgatgagcttggcgggaggtgcc
gtggtgctggccttggaaggtggccatgacctcacagccatctgtgacgcttctgaggcc
tgcgtggctgctcttctggggaacaaggtggaccctctctcagaagagggctggaaacag
aaacccaacctcaacgccatccgctctttggaagccgtgatccgggtgcacagtaaatac
tggggctgcatgcagcgcctggcttcccgtccagactcctgggcgcccagggcgccaggc
gccgacacggaagaagtggaggcggtgacggcgttggcatccctctccgtgggcatcctg
gctgaagagcggccctcggaacagctggtggaggaggaagaacccatgactctctaa

DBGET integrated database retrieval system