KEGG   Ailuropoda melanoleuca (giant panda): 100474542Help
Entry
100474542         CDS       T01329                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aml00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aml00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:aml00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:aml00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aml00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aml04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 668 aa AA seqDB search
MDLRGVVRILSLLLVPLLLASARGLSKASQRTFKIDYSHNRFLKDGRPFRYISGSIHYFR
VPRFYWKDRLLKMKMAGLNAIQSYVPWNFHEPQPGQYQFSGEHDVEYFIKLAHELGLLVI
LRPGPYICAEWDMGGLPAWLLLKESIILRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGP
IITVQVENEYGSYFSCDYDHLRFLQKLFHYHLGNDVLLFTTDGAHEMFLKCGALQGLYAT
VDFGPGANITAAFEIQRKSEPRGPLVNSEFYTGWLDHWGQPHSTAKTEVVASALHEILSR
GANVNLYMFIGGTNFAYWNGANMPYQAQPTSYDYDAPLSEAGDLTEKYFALRDVIRKFEK
VPEGFIPPSTPKFAYGKVVLKKLKTVGDALNILCPPGPIKSLYPLTFIQVKQYFGFVLYR
TTLPQDCSDPTPLSSPLSGVHDRAYVAVDGVPQGVLERSDVITLNITGKAGATLDLLVEN
MGRVNYGRYINDFKGLISNLTLGSNILTDWMIFPLDTDNAVRKHLGGWDGYNNGRHDKPL
DHSSSNYKLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQM
TLFVPRHILVTSAPNTIMVLELEHAPCGDNGPELCAVEFVDRPVINATLTSGHSPPHLPD
QQSGMDYV
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggacttgcggggggtggttcgcattctctcactactgctggtgccgctgctgctggct
tctgcgcgcggcctgagcaaagcttcccaaaggacgttcaagattgactacagtcacaac
cgcttcctgaaggatggccggcccttccgctacatctcgggaagcattcactatttccgc
gtgccccgcttctactggaaggatcggctgctgaagatgaagatggccgggctgaacgcc
atccagtcgtatgtgccctggaactttcacgagccccagccaggacagtaccagttttct
ggggaacatgatgtggaatattttattaagctggcccatgagctgggactgctggtcatc
ctgaggcctggaccctacatctgtgcagagtgggacatgggaggattacctgcttggcta
ttattaaaagaatctattattctccgttcttcggatccagactaccttgcagccgtggac
aagtggttgggagtcctcctgcccaagatgaagcctctgctctatcagaacggggggccg
atcataaccgtgcaggttgaaaatgaatatggcagctacttcagctgtgattatgaccac
ctgcgtttcctgcagaagctcttccactaccatctgggcaatgacgtgctgctgttcacc
actgatggggcacatgagatgttcctaaagtgcggggcactgcaggggctctatgccaca
gtggacttcggaccaggtgccaacatcaccgctgctttcgaaatccagagaaagagtgag
cccagagggccattggtgaattctgaattctataccggctggttagaccattggggccaa
cctcactcaacagcgaagactgaagttgtggcttccgccctccatgagatactttcccgt
ggggcaaatgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggg
gccaacatgccctaccaagcgcagcccaccagctacgattatgacgccccactgagcgag
gcaggggacctcactgagaagtattttgctctgcgagacgttattcggaagtttgaaaaa
gtaccagaaggttttatccctccgtctacacccaagtttgcatatggaaaagttgttctg
aagaagttaaagacagtgggggatgcactgaacattctgtgtccgcctgggcccataaaa
agcctttatcccttgacgtttatccaggtgaaacagtattttgggtttgtgctgtaccgc
acaacgcttcctcaagactgcagtgaccccacacccctgtcgtcacccctcagtggagtc
cacgaccgggcctatgtcgccgtggatggggtgccccagggagtcctggagcgaagtgat
gtgatcactctgaatatcaccgggaaagctggagccactctggaccttctagtggagaac
atgggacgtgtgaactacggcagatatatcaatgattttaagggtcttatttctaacctg
acccttggttccaatatcctcacggactggatgatcttcccactggacactgacaatgcg
gtgcgcaaacacctaggaggctgggatggctataacaatggccgccatgataaacccttg
gaccacagctcatcgaattacaaactgccggccttttatatggggaacttctctattccc
agtggaatcccagacttgccccaggacacctttatccagtttcctggatggaccaagggt
caggtgtggattaatggctttaacctcgggcgatactggccagcacggggcccccagatg
actttgtttgtaccacggcacatcctggtgacatcggccccaaacaccatcatggtgctg
gaactggagcacgcgccctgtggcgacaatggcccggagctgtgtgccgtggagtttgtg
gacaggccggtgatcaatgccactctgacctctggtcattcccctccacacctgcctgat
caacagtcaggaatggactatgtctga

DBGET integrated database retrieval system