KEGG   Ailuropoda melanoleuca (giant panda): 100474573Help
Entry
100474573         CDS       T01329                                 

Gene name
ACACA
Definition
(RefSeq) acetyl-CoA carboxylase alpha
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100474573 (ACACA)
   00640 Propanoate metabolism
    100474573 (ACACA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100474573 (ACACA)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100474573 (ACACA)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100474573 (ACACA)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100474573 (ACACA)
   04922 Glucagon signaling pathway
    100474573 (ACACA)
Enzymes [BR:aml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100474573 (ACACA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100474573 (ACACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 2383 aa AA seqDB search
MWWSTLMSILRASSFWRWISAQTVRIIRALRAHFEGKMDEPSPLAKPLELNQHSRFIIGS
VSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHMRSSMSGLH
LVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYE
MFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQ
AVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGS
GLRVDWHENDFSKRILNVPQELYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRK
VNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRR
HQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQ
VEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRG
HVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSW
GENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIAEKVQA
ERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVLPAHTLLNTVDVELIYGGVKYVL
KVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTC
VFEKENDPSVLRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAAESGCIHYVK
RPGTALDPGCVIAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNV
MNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMA
QYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHM
KAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTM
LIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESI
FLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYEL
NSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHYGMTHVASVSDVLLD
NSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPPQSPTFPEAGHTSLYDEDKVPRD
EPIHILNVAIKTDCDIEDDGLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNCE
VDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHL
YLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNN
TNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTG
KAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINTPYVTKDLL
QSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQG
QLVHMNRLPGGNEIGMVAWKMTLKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRAS
ELARAEGIPRIFVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRVSA
LNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYDEIITISLVTCR
AIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHS
IVCDDFEGVFTVLHWLSYMPKSVRSSVPLLNSKDPIDRIIEFVPTKAPYDPRWMLAGRPH
PTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPAN
LDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKF
GAYIVDSLRECSQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADRESRGSVLEPEGT
VEIKFRRKDLVKTMRRVDPVYIRLAERLGTPELSPAERKELENKLKEREEFLIPIYHQVA
VQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQ
IQAMLRRWFVEVEGTVKAYIWDNNKDLVEWLEKQLTEEDGVRSVIEENIKYISRDYVLKQ
IRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPST
NT seq 7152 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggtccactttgatgtcaatcttgagggctagttctttttggaggtggatatct
gctcagacagtaagaattataagagctctgagagctcattttgaaggaaaaatggatgaa
ccatcccctttggccaaacctctggagctgaaccagcactcccgattcataattggttct
gtgtctgaagataactcagaggatgaaattagcaacctggtgaagctggatctactggag
gagaaggagggctctctgtcaccggcgtctgttggctcagatacactctctgatttgggg
atctccagcctacaggatggcttggccttacacatgaggtccagcatgtctggcttgcat
ctagtaaagcaaggtcgagaccgaaagaaaatagactctcagcgagatttcactgtagct
tctccagcagaatttgttactcgttttggggggaataaagtgattgagaaggttcttatc
gccaacaatgggattgcagcagtgaaatgcatgcggtctatccgtcgatggtcttatgag
atgtttcgaaatgaacgtgcaatccgatttgttgttatggtaacacctgaagacctgaaa
gccaatgcagaatacattaagatggcagatcactatgtgccagtgccaggaggaccaaac
aacaacaactatgcaaacgtggaattaattcttgatattgctaaaaggattccagtacaa
gcagtgtgggctggctggggtcatgcttctgagaatcccaagctcccagaacttcttttg
aaaaatggcatcgccttcatgggtcctccaagccaggccatgtgggctttgggggataag
attgcatcttccatagtggctcaaactgcaggtatcccaactcttccctggagtggcagt
ggtcttcgtgtggactggcatgaaaatgatttttcaaaacgtatcttaaatgttccccag
gaattatatgaaaaaggttatgtgaaggatgtggatgatgggctgaaggcagcagaggaa
gttggatatccagtaatgatcaaggcctcagaaggaggtggagggaaaggaatcagaaaa
gtcaacaatgcagatgacttccctaatctcttcagacaggttcaagctgaagtccctgga
tctcctatatttgtgatgagactagccaaacaatctcgtcatctggaggtacagatctta
gcagatcaatatggcaatgctatctctctctttggtcgtgactgctctgtacagcgcagg
catcagaagattattgaggaagcacctgctgcgatcgctactccagcagtatttgaacat
atggaacagtgtgcggtgaaacttgccaaaatggttggttatgtgagtgctgggactgtg
gaatacctctacagccaggatggcagcttctactttctggaactgaaccctcggctgcag
gtggagcacccctgtacagagatggtggctgatgtcaacctccccgcagcacaactccag
attgccatggggatccctctgtacagaatcaaggatattcgtatgatgtatggggtatct
ccctggggcgatgctcccattgattttgaaaattctgctcatgttccttgcccaaggggc
catgttattgctgctcggatcaccagtgaaaatccggatgagggttttaagcccagctca
ggaacagttcaggaactgaatttccgaagcaataagaacgtttggggttatttcagtgtt
gctgctgcagggggccttcatgaatttgctgattctcagtttggtcactgcttctcctgg
ggagaaaacagagaggaagcaatttcaaacatggtggtggctttgaaggagctatctatt
cggggtgactttcgaactacagttgaatacctcatcaaattgttggagactgaaagcttt
cagttgaatagaattgacactggctggctggacagactgatagcagagaaagtacaggca
gagcgacctgacaccatgttgggagttgtatgtggggctctccacgtggcagatgtgagc
ctacggaatagcatctctaacttccttcactccttagaaaggggtcaagtccttcctgca
catacacttctgaatacagtagatgttgagcttatctatgggggagtcaaatatgtactt
aaggtgacccggcagtcccccaactcctatgtggtgatcatgaatggttcatgcgttgaa
gtagacgtgcatcggctgagtgatggagggctgctcctgtcttatgatggcagcagttat
actacatacatgaaggaggaagtggataggtatcgcatcacaatcggcaataagacctgt
gtgtttgagaaggaaaatgacccttcggtgttgcgctcaccttctgctgggaagttaatc
cagtacattgtggaggatggaggccatgtgtttgctggccagtgctatgccgagattgag
gtgatgaagatggtaatgaccttaacagctgcagagtctggctgtatccattatgtcaaa
cggcctggaacagctcttgaccctggctgtgtgatagccaaaatgcagttggacaaccct
agcaaggtccaacaggctgagcttcacacgggtagtctgccacggatccagagcacagca
ctcagaggcgagaagctccaccgagtgttccactatgttctggataatctggtcaacgta
atgaatggatactgccttccagatcctttttttagcagcagggtgaaagactgggttgag
cggttgatgaagaccctcagagatccctccttgcctctgctagaattgcaggatatcatg
accagtgtctctggccgtattccccccaatgtggagaagtctatcaagaaggaaatggct
cagtacgctagcaacatcacatcagtcctctgtcagtttcccagccagcagattgccaac
atcctagatagccatgcagctacattgaaccggaaatctgagcgggaagtcttcttcatg
aacactcagagcattgtccagctggtacagaggtaccgaagtggcatccgaggccacatg
aaggctgtggtgatggatctgctgcggcagtacctgcgagtagagacccagttccagaat
ggtcactatgacaaatgtgtgttcgcccttcgagaagagaacaagagtgacatgaacact
gtactgaactatatcttctctcacgctcaagtcaccaagaagaatcttctggtcacaatg
cttattgaccagttgtgcggtcgggaccctactctcaccgacgagctgctgaatatcctc
acagagctaactcagctcagtaagaccaccaatgccaaagtggcgctccgagcacgccag
gttcttattgcatcccatttgccatcatatgagcttcgccataaccaagtagagtccatc
ttcctttcagcaattgacatgtacggacatcagttttgcattgagaacctgcagaaactc
atcttgtctgaaacgtctatttttgacgtcctaccaaacttcttctatcacagcaaccag
gtagtgaggatggcagctctggaggtttatgttcgaagggcttatattgcctatgaactt
aacagtgtacaacatcgccagcttaaggacaacacctgtgtggtggaattccagttcatg
ctgcccacatctcatccaaacagagggaacatccccacgctaaacagaatgtccttctcc
tccaacctcaaccactatggcatgactcacgtagctagtgtcagcgatgtgctgttggac
aactcattcactccaccatgtcagcggatgggcggaatggtctcttttcggacttttgaa
gattttgtcaggatctttgatgaagtgatgggctgcttctgcgattccccaccccaaagc
cccacgttccctgaggcaggtcacacgtctctatacgatgaagacaaggtccccagggat
gaaccaattcacattctgaatgtggctatcaagactgactgtgatattgaggatgacgga
ctggcagctatgttcagagagtttacccaacaaaacaaagctaccttggttgagcatggg
atacggcgccttactttcctggttgcacaaaaggatttcagaaaacaggtcaactgtgag
gtggatcagagatttcatagagaatttcctaaatttttcaccttccgagcgagggataag
tttgaggaggatcgtatctatcgtcacttggaacctgccctagctttccagttagagctg
aaccggatgagaaattttgaccttactgccattccatgtgctaatcataagatgcacctg
tatcttggggcagccaaggtggaagtgggcacagaagtgacagactacaggttcttcgtt
cgtgcaatcatcagacattctgatctggtcaccaaggaagcttcttttgaatatctacaa
aatgaaggggagaggctgctcctagaagccatggatgagttggaagttgcttttaataat
acaaatgttcgcactgactgcaaccacatcttcctcaactttgtgcccacagtcatcatg
gacccatcaaagattgaggaatctgtgcggagcatggtaatgcgctatggaagtcggctg
tggaaattacgcgtcctccaggcagaactgaaaatcaacattcgcctgacaccaactgga
aaagcaattcccatccgcctcttcctgacaaacgagtctggctattacttggacatcagc
ttgtacaaggaagtgactgactccaggacagcacagatcatgtttcaggcatatggagac
aaacagggaccattgcatggaatgttaatcaacactccatatgtcaccaaagacctgctt
caatcaaagagattccaggcacaatccttggggacaacatacatatatgatatcccagag
atgtttcgacagtctctgatcaaactctgggagtctatgtccactcaagcattccttcca
tcaccccctctgccttctgacatgctgacctatacggagcttgtgttggatgatcaaggt
cagctggtccacatgaacaggcttccaggaggaaatgagattggcatggtagcttggaaa
atgactcttaaaagtcctgaatacccagaaggccgagatatcattgttattgggaatgac
atcacataccgaattgggtcctttgggccgcaggaggatttgctgtttcttagagcttct
gagcttgccagggcagagggtatcccacgcatctttgtagcagccaacagtggagcaaga
atcggactggcagaagaaattcgtcatatgtttcatgtggcctgggtagatcctgaggat
ccttacaagggatacaaatatttatatctgacccctcaggattacaagagagtcagtgct
ctcaactctgtccactgtgaacatgtagaggacgagggagaatccaggtacaagataact
gatattattgggaaggaagagggacttggagcagagaaccttcgaggctctggaatgatt
gctggagaatcctcattggcctatgatgagatcatcaccatcagcctggttacatgccgg
gccattgggattggggcttaccttgttcggctgggacagagaaccatccaggttgaaaat
tctcacttaattctgactggagctggggccctcaacaaagtccttgggcgggaggtatac
acctccaataaccagctcgggggcatccagatcatgcacaacaatggggtgacccacagc
atcgtttgcgatgacttcgaaggggttttcactgtcctgcactggctgtcttacatgcct
aagagtgtgcgcagttcagttcctctcctgaactccaaggatcctatagatagaatcatc
gagtttgttcccacgaaggccccatatgatcctcgatggatgctagcaggccgacctcac
ccaacccagaaaggtcagtggttgagtggattttttgactatggatctttctcagagatc
atgcagccctgggcccagactgtggtggtcggcagagccaggctaggaggaatacctgtg
ggagtggttgccgtagaaacccgaacagtggaactgagtatcccagctgatcctgcaaac
ctggattctgaagccaagataatccagcaggctggccaggtttggttcccagactctgcg
tttaagacctatcaggctatcaaggacttcaaccgtgaagggctgcctctgatggtcttt
gccaactggagaggcttctctggtgggatgaaagatatgtacgaccaagtgctgaagttt
ggtgcttacattgtggatagcttacgggagtgctcccagccagtgctggtgtacattcct
cctcaggctgagctccgggggggctcctgggttgtgatcgaccccaccatcaacccccgg
cacatggagatgtacgctgaccgagagagcaggggatcagttctggagccagaggggaca
gtagaaatcaaattccgcagaaaggatctggtgaaaaccatgcgtcgggtggacccagtc
tacattcgcttggctgagcgattgggcaccccagagctaagcccagctgagcggaaggaa
ctggagaacaagttgaaggagcgggaggaattcctaattcccatttaccatcaggtagcc
gtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggtgttattaac
gatatcctggactggaaaacatcccgtactttcttctactggcggctgaggcgtctcctg
ctggaggacctggtcaaaaagaaaatccacaatgccaacccagagctgaccgatggccag
atccaggccatgttacggcgttggtttgtagaagtggaaggaactgtgaaggcctacatt
tgggacaataacaaggatctggtggagtggctggagaagcaactgaccgaggaagatggc
gttcgctcagtaatcgaggaaaacatcaagtatatcagcagagactacgtcctcaagcag
atccgcagcttggtacaggccaatcccgaggttgccatggactccatcgttcatatgact
cagcacatctcgcccacgcagcgagcagaagtcgtgcggatcctctccacgatggactcc
ccttcaacgtag

DBGET integrated database retrieval system