KEGG   Ailuropoda melanoleuca (giant panda): 100474573Help
Entry
100474573         CDS       T01329                                 

Definition
acetyl-CoA carboxylase 1-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aml01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aml00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aml00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:aml00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:aml04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2385 aa AA seqDB search
MFIEVCNWKRHLVKCSFWRWISAQTVRIIRALRAHFEGKMDEPSPLAKPLELNQHSRFII
GSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHMRSSMSG
LHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWS
YEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIP
VQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWS
GSGLRVDWHENDFSKRILNVPQELYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGI
RKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQ
RRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPR
LQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDAPIDFENSAHVPCP
RGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCF
SWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIAEKV
QAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVLPAHTLLNTVDVELIYGGVKY
VLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNK
TCVFEKENDPSVLRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAAESGCIHY
VKRPGTALDPGCVIAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLV
NVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKE
MAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRG
HMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLV
TMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVE
SIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAY
ELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHYGMTHVASVSDVL
LDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPPQSPTFPEAGHTSLYDEDKVP
RDEPIHILNVAIKTDCDIEDDGLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVN
CEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKM
HLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAF
NNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTP
TGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINTPYVTKD
LLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDD
QGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLR
ASELARAEGIPRIFVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRV
SALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYDEIITISLVT
CRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVT
HSIVCDDFEGVFTVLHWLSYMPKSVRSSVPLLNSKDPIDRIIEFVPTKAPYDPRWMLAGR
PHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADP
ANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVL
KFGAYIVDSLRECSQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADRESRGSVLEPE
GTVEIKFRRKDLVKTMRRVDPVYIRLAERLGTPELSPAERKELENKLKEREEFLIPIYHQ
VAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTD
GQIQAMLRRWFVEVEGTVKAYIWDNNKDLVEWLEKQLTEEDGVRSVIEENIKYISRDYVL
KQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPST
NT seq 7158 nt NT seq  +upstreamnt  +downstreamnt
atgttcattgaagtatgcaattggaaaaggcacctggtgaaatgttctttttggaggtgg
atatctgctcagacagtaagaattataagagctctgagagctcattttgaaggaaaaatg
gatgaaccatcccctttggccaaacctctggagctgaaccagcactcccgattcataatt
ggttctgtgtctgaagataactcagaggatgaaattagcaacctggtgaagctggatcta
ctggaggagaaggagggctctctgtcaccggcgtctgttggctcagatacactctctgat
ttggggatctccagcctacaggatggcttggccttacacatgaggtccagcatgtctggc
ttgcatctagtaaagcaaggtcgagaccgaaagaaaatagactctcagcgagatttcact
gtagcttctccagcagaatttgttactcgttttggggggaataaagtgattgagaaggtt
cttatcgccaacaatgggattgcagcagtgaaatgcatgcggtctatccgtcgatggtct
tatgagatgtttcgaaatgaacgtgcaatccgatttgttgttatggtaacacctgaagac
ctgaaagccaatgcagaatacattaagatggcagatcactatgtgccagtgccaggagga
ccaaacaacaacaactatgcaaacgtggaattaattcttgatattgctaaaaggattcca
gtacaagcagtgtgggctggctggggtcatgcttctgagaatcccaagctcccagaactt
cttttgaaaaatggcatcgccttcatgggtcctccaagccaggccatgtgggctttgggg
gataagattgcatcttccatagtggctcaaactgcaggtatcccaactcttccctggagt
ggcagtggtcttcgtgtggactggcatgaaaatgatttttcaaaacgtatcttaaatgtt
ccccaggaattatatgaaaaaggttatgtgaaggatgtggatgatgggctgaaggcagca
gaggaagttggatatccagtaatgatcaaggcctcagaaggaggtggagggaaaggaatc
agaaaagtcaacaatgcagatgacttccctaatctcttcagacaggttcaagctgaagtc
cctggatctcctatatttgtgatgagactagccaaacaatctcgtcatctggaggtacag
atcttagcagatcaatatggcaatgctatctctctctttggtcgtgactgctctgtacag
cgcaggcatcagaagattattgaggaagcacctgctgcgatcgctactccagcagtattt
gaacatatggaacagtgtgcggtgaaacttgccaaaatggttggttatgtgagtgctggg
actgtggaatacctctacagccaggatggcagcttctactttctggaactgaaccctcgg
ctgcaggtggagcacccctgtacagagatggtggctgatgtcaacctccccgcagcacaa
ctccagattgccatggggatccctctgtacagaatcaaggatattcgtatgatgtatggg
gtatctccctggggcgatgctcccattgattttgaaaattctgctcatgttccttgccca
aggggccatgttattgctgctcggatcaccagtgaaaatccggatgagggttttaagccc
agctcaggaacagttcaggaactgaatttccgaagcaataagaacgtttggggttatttc
agtgttgctgctgcagggggccttcatgaatttgctgattctcagtttggtcactgcttc
tcctggggagaaaacagagaggaagcaatttcaaacatggtggtggctttgaaggagcta
tctattcggggtgactttcgaactacagttgaatacctcatcaaattgttggagactgaa
agctttcagttgaatagaattgacactggctggctggacagactgatagcagagaaagta
caggcagagcgacctgacaccatgttgggagttgtatgtggggctctccacgtggcagat
gtgagcctacggaatagcatctctaacttccttcactccttagaaaggggtcaagtcctt
cctgcacatacacttctgaatacagtagatgttgagcttatctatgggggagtcaaatat
gtacttaaggtgacccggcagtcccccaactcctatgtggtgatcatgaatggttcatgc
gttgaagtagacgtgcatcggctgagtgatggagggctgctcctgtcttatgatggcagc
agttatactacatacatgaaggaggaagtggataggtatcgcatcacaatcggcaataag
acctgtgtgtttgagaaggaaaatgacccttcggtgttgcgctcaccttctgctgggaag
ttaatccagtacattgtggaggatggaggccatgtgtttgctggccagtgctatgccgag
attgaggtgatgaagatggtaatgaccttaacagctgcagagtctggctgtatccattat
gtcaaacggcctggaacagctcttgaccctggctgtgtgatagccaaaatgcagttggac
aaccctagcaaggtccaacaggctgagcttcacacgggtagtctgccacggatccagagc
acagcactcagaggcgagaagctccaccgagtgttccactatgttctggataatctggtc
aacgtaatgaatggatactgccttccagatcctttttttagcagcagggtgaaagactgg
gttgagcggttgatgaagaccctcagagatccctccttgcctctgctagaattgcaggat
atcatgaccagtgtctctggccgtattccccccaatgtggagaagtctatcaagaaggaa
atggctcagtacgctagcaacatcacatcagtcctctgtcagtttcccagccagcagatt
gccaacatcctagatagccatgcagctacattgaaccggaaatctgagcgggaagtcttc
ttcatgaacactcagagcattgtccagctggtacagaggtaccgaagtggcatccgaggc
cacatgaaggctgtggtgatggatctgctgcggcagtacctgcgagtagagacccagttc
cagaatggtcactatgacaaatgtgtgttcgcccttcgagaagagaacaagagtgacatg
aacactgtactgaactatatcttctctcacgctcaagtcaccaagaagaatcttctggtc
acaatgcttattgaccagttgtgcggtcgggaccctactctcaccgacgagctgctgaat
atcctcacagagctaactcagctcagtaagaccaccaatgccaaagtggcgctccgagca
cgccaggttcttattgcatcccatttgccatcatatgagcttcgccataaccaagtagag
tccatcttcctttcagcaattgacatgtacggacatcagttttgcattgagaacctgcag
aaactcatcttgtctgaaacgtctatttttgacgtcctaccaaacttcttctatcacagc
aaccaggtagtgaggatggcagctctggaggtttatgttcgaagggcttatattgcctat
gaacttaacagtgtacaacatcgccagcttaaggacaacacctgtgtggtggaattccag
ttcatgctgcccacatctcatccaaacagagggaacatccccacgctaaacagaatgtcc
ttctcctccaacctcaaccactatggcatgactcacgtagctagtgtcagcgatgtgctg
ttggacaactcattcactccaccatgtcagcggatgggcggaatggtctcttttcggact
tttgaagattttgtcaggatctttgatgaagtgatgggctgcttctgcgattccccaccc
caaagccccacgttccctgaggcaggtcacacgtctctatacgatgaagacaaggtcccc
agggatgaaccaattcacattctgaatgtggctatcaagactgactgtgatattgaggat
gacggactggcagctatgttcagagagtttacccaacaaaacaaagctaccttggttgag
catgggatacggcgccttactttcctggttgcacaaaaggatttcagaaaacaggtcaac
tgtgaggtggatcagagatttcatagagaatttcctaaatttttcaccttccgagcgagg
gataagtttgaggaggatcgtatctatcgtcacttggaacctgccctagctttccagtta
gagctgaaccggatgagaaattttgaccttactgccattccatgtgctaatcataagatg
cacctgtatcttggggcagccaaggtggaagtgggcacagaagtgacagactacaggttc
ttcgttcgtgcaatcatcagacattctgatctggtcaccaaggaagcttcttttgaatat
ctacaaaatgaaggggagaggctgctcctagaagccatggatgagttggaagttgctttt
aataatacaaatgttcgcactgactgcaaccacatcttcctcaactttgtgcccacagtc
atcatggacccatcaaagattgaggaatctgtgcggagcatggtaatgcgctatggaagt
cggctgtggaaattacgcgtcctccaggcagaactgaaaatcaacattcgcctgacacca
actggaaaagcaattcccatccgcctcttcctgacaaacgagtctggctattacttggac
atcagcttgtacaaggaagtgactgactccaggacagcacagatcatgtttcaggcatat
ggagacaaacagggaccattgcatggaatgttaatcaacactccatatgtcaccaaagac
ctgcttcaatcaaagagattccaggcacaatccttggggacaacatacatatatgatatc
ccagagatgtttcgacagtctctgatcaaactctgggagtctatgtccactcaagcattc
cttccatcaccccctctgccttctgacatgctgacctatacggagcttgtgttggatgat
caaggtcagctggtccacatgaacaggcttccaggaggaaatgagattggcatggtagct
tggaaaatgactcttaaaagtcctgaatacccagaaggccgagatatcattgttattggg
aatgacatcacataccgaattgggtcctttgggccgcaggaggatttgctgtttcttaga
gcttctgagcttgccagggcagagggtatcccacgcatctttgtagcagccaacagtgga
gcaagaatcggactggcagaagaaattcgtcatatgtttcatgtggcctgggtagatcct
gaggatccttacaagggatacaaatatttatatctgacccctcaggattacaagagagtc
agtgctctcaactctgtccactgtgaacatgtagaggacgagggagaatccaggtacaag
ataactgatattattgggaaggaagagggacttggagcagagaaccttcgaggctctgga
atgattgctggagaatcctcattggcctatgatgagatcatcaccatcagcctggttaca
tgccgggccattgggattggggcttaccttgttcggctgggacagagaaccatccaggtt
gaaaattctcacttaattctgactggagctggggccctcaacaaagtccttgggcgggag
gtatacacctccaataaccagctcgggggcatccagatcatgcacaacaatggggtgacc
cacagcatcgtttgcgatgacttcgaaggggttttcactgtcctgcactggctgtcttac
atgcctaagagtgtgcgcagttcagttcctctcctgaactccaaggatcctatagataga
atcatcgagtttgttcccacgaaggccccatatgatcctcgatggatgctagcaggccga
cctcacccaacccagaaaggtcagtggttgagtggattttttgactatggatctttctca
gagatcatgcagccctgggcccagactgtggtggtcggcagagccaggctaggaggaata
cctgtgggagtggttgccgtagaaacccgaacagtggaactgagtatcccagctgatcct
gcaaacctggattctgaagccaagataatccagcaggctggccaggtttggttcccagac
tctgcgtttaagacctatcaggctatcaaggacttcaaccgtgaagggctgcctctgatg
gtctttgccaactggagaggcttctctggtgggatgaaagatatgtacgaccaagtgctg
aagtttggtgcttacattgtggatagcttacgggagtgctcccagccagtgctggtgtac
attcctcctcaggctgagctccgggggggctcctgggttgtgatcgaccccaccatcaac
ccccggcacatggagatgtacgctgaccgagagagcaggggatcagttctggagccagag
gggacagtagaaatcaaattccgcagaaaggatctggtgaaaaccatgcgtcgggtggac
ccagtctacattcgcttggctgagcgattgggcaccccagagctaagcccagctgagcgg
aaggaactggagaacaagttgaaggagcgggaggaattcctaattcccatttaccatcag
gtagccgtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggtgtt
attaacgatatcctggactggaaaacatcccgtactttcttctactggcggctgaggcgt
ctcctgctggaggacctggtcaaaaagaaaatccacaatgccaacccagagctgaccgat
ggccagatccaggccatgttacggcgttggtttgtagaagtggaaggaactgtgaaggcc
tacatttgggacaataacaaggatctggtggagtggctggagaagcaactgaccgaggaa
gatggcgttcgctcagtaatcgaggaaaacatcaagtatatcagcagagactacgtcctc
aagcagatccgcagcttggtacaggccaatcccgaggttgccatggactccatcgttcat
atgactcagcacatctcgcccacgcagcgagcagaagtcgtgcggatcctctccacgatg
gactccccttcaacgtag

DBGET integrated database retrieval system