KEGG   Ailuropoda melanoleuca (giant panda): 100474573Help
Entry
100474573         CDS       T01329                                 

Definition
acetyl-CoA carboxylase 1-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100474573
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100474573
   00640 Propanoate metabolism
    100474573
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100474573
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100474573
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100474573
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100474573
Enzymes [BR:aml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100474573
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100474573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2385 aa AA seqDB search
MFIEVCNWKRHLVKCSFWRWISAQTVRIIRALRAHFEGKMDEPSPLAKPLELNQHSRFII
GSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHMRSSMSG
LHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWS
YEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIP
VQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWS
GSGLRVDWHENDFSKRILNVPQELYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGI
RKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQ
RRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPR
LQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDAPIDFENSAHVPCP
RGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCF
SWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIAEKV
QAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVLPAHTLLNTVDVELIYGGVKY
VLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNK
TCVFEKENDPSVLRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAAESGCIHY
VKRPGTALDPGCVIAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLV
NVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKE
MAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRG
HMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLV
TMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVE
SIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAY
ELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHYGMTHVASVSDVL
LDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPPQSPTFPEAGHTSLYDEDKVP
RDEPIHILNVAIKTDCDIEDDGLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVN
CEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKM
HLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAF
NNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTP
TGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINTPYVTKD
LLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDD
QGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLR
ASELARAEGIPRIFVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRV
SALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYDEIITISLVT
CRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVT
HSIVCDDFEGVFTVLHWLSYMPKSVRSSVPLLNSKDPIDRIIEFVPTKAPYDPRWMLAGR
PHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADP
ANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVL
KFGAYIVDSLRECSQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADRESRGSVLEPE
GTVEIKFRRKDLVKTMRRVDPVYIRLAERLGTPELSPAERKELENKLKEREEFLIPIYHQ
VAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTD
GQIQAMLRRWFVEVEGTVKAYIWDNNKDLVEWLEKQLTEEDGVRSVIEENIKYISRDYVL
KQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPST
NT seq 7158 nt NT seq  +upstreamnt  +downstreamnt
atgttcattgaagtatgcaattggaaaaggcacctggtgaaatgttctttttggaggtgg
atatctgctcagacagtaagaattataagagctctgagagctcattttgaaggaaaaatg
gatgaaccatcccctttggccaaacctctggagctgaaccagcactcccgattcataatt
ggttctgtgtctgaagataactcagaggatgaaattagcaacctggtgaagctggatcta
ctggaggagaaggagggctctctgtcaccggcgtctgttggctcagatacactctctgat
ttggggatctccagcctacaggatggcttggccttacacatgaggtccagcatgtctggc
ttgcatctagtaaagcaaggtcgagaccgaaagaaaatagactctcagcgagatttcact
gtagcttctccagcagaatttgttactcgttttggggggaataaagtgattgagaaggtt
cttatcgccaacaatgggattgcagcagtgaaatgcatgcggtctatccgtcgatggtct
tatgagatgtttcgaaatgaacgtgcaatccgatttgttgttatggtaacacctgaagac
ctgaaagccaatgcagaatacattaagatggcagatcactatgtgccagtgccaggagga
ccaaacaacaacaactatgcaaacgtggaattaattcttgatattgctaaaaggattcca
gtacaagcagtgtgggctggctggggtcatgcttctgagaatcccaagctcccagaactt
cttttgaaaaatggcatcgccttcatgggtcctccaagccaggccatgtgggctttgggg
gataagattgcatcttccatagtggctcaaactgcaggtatcccaactcttccctggagt
ggcagtggtcttcgtgtggactggcatgaaaatgatttttcaaaacgtatcttaaatgtt
ccccaggaattatatgaaaaaggttatgtgaaggatgtggatgatgggctgaaggcagca
gaggaagttggatatccagtaatgatcaaggcctcagaaggaggtggagggaaaggaatc
agaaaagtcaacaatgcagatgacttccctaatctcttcagacaggttcaagctgaagtc
cctggatctcctatatttgtgatgagactagccaaacaatctcgtcatctggaggtacag
atcttagcagatcaatatggcaatgctatctctctctttggtcgtgactgctctgtacag
cgcaggcatcagaagattattgaggaagcacctgctgcgatcgctactccagcagtattt
gaacatatggaacagtgtgcggtgaaacttgccaaaatggttggttatgtgagtgctggg
actgtggaatacctctacagccaggatggcagcttctactttctggaactgaaccctcgg
ctgcaggtggagcacccctgtacagagatggtggctgatgtcaacctccccgcagcacaa
ctccagattgccatggggatccctctgtacagaatcaaggatattcgtatgatgtatggg
gtatctccctggggcgatgctcccattgattttgaaaattctgctcatgttccttgccca
aggggccatgttattgctgctcggatcaccagtgaaaatccggatgagggttttaagccc
agctcaggaacagttcaggaactgaatttccgaagcaataagaacgtttggggttatttc
agtgttgctgctgcagggggccttcatgaatttgctgattctcagtttggtcactgcttc
tcctggggagaaaacagagaggaagcaatttcaaacatggtggtggctttgaaggagcta
tctattcggggtgactttcgaactacagttgaatacctcatcaaattgttggagactgaa
agctttcagttgaatagaattgacactggctggctggacagactgatagcagagaaagta
caggcagagcgacctgacaccatgttgggagttgtatgtggggctctccacgtggcagat
gtgagcctacggaatagcatctctaacttccttcactccttagaaaggggtcaagtcctt
cctgcacatacacttctgaatacagtagatgttgagcttatctatgggggagtcaaatat
gtacttaaggtgacccggcagtcccccaactcctatgtggtgatcatgaatggttcatgc
gttgaagtagacgtgcatcggctgagtgatggagggctgctcctgtcttatgatggcagc
agttatactacatacatgaaggaggaagtggataggtatcgcatcacaatcggcaataag
acctgtgtgtttgagaaggaaaatgacccttcggtgttgcgctcaccttctgctgggaag
ttaatccagtacattgtggaggatggaggccatgtgtttgctggccagtgctatgccgag
attgaggtgatgaagatggtaatgaccttaacagctgcagagtctggctgtatccattat
gtcaaacggcctggaacagctcttgaccctggctgtgtgatagccaaaatgcagttggac
aaccctagcaaggtccaacaggctgagcttcacacgggtagtctgccacggatccagagc
acagcactcagaggcgagaagctccaccgagtgttccactatgttctggataatctggtc
aacgtaatgaatggatactgccttccagatcctttttttagcagcagggtgaaagactgg
gttgagcggttgatgaagaccctcagagatccctccttgcctctgctagaattgcaggat
atcatgaccagtgtctctggccgtattccccccaatgtggagaagtctatcaagaaggaa
atggctcagtacgctagcaacatcacatcagtcctctgtcagtttcccagccagcagatt
gccaacatcctagatagccatgcagctacattgaaccggaaatctgagcgggaagtcttc
ttcatgaacactcagagcattgtccagctggtacagaggtaccgaagtggcatccgaggc
cacatgaaggctgtggtgatggatctgctgcggcagtacctgcgagtagagacccagttc
cagaatggtcactatgacaaatgtgtgttcgcccttcgagaagagaacaagagtgacatg
aacactgtactgaactatatcttctctcacgctcaagtcaccaagaagaatcttctggtc
acaatgcttattgaccagttgtgcggtcgggaccctactctcaccgacgagctgctgaat
atcctcacagagctaactcagctcagtaagaccaccaatgccaaagtggcgctccgagca
cgccaggttcttattgcatcccatttgccatcatatgagcttcgccataaccaagtagag
tccatcttcctttcagcaattgacatgtacggacatcagttttgcattgagaacctgcag
aaactcatcttgtctgaaacgtctatttttgacgtcctaccaaacttcttctatcacagc
aaccaggtagtgaggatggcagctctggaggtttatgttcgaagggcttatattgcctat
gaacttaacagtgtacaacatcgccagcttaaggacaacacctgtgtggtggaattccag
ttcatgctgcccacatctcatccaaacagagggaacatccccacgctaaacagaatgtcc
ttctcctccaacctcaaccactatggcatgactcacgtagctagtgtcagcgatgtgctg
ttggacaactcattcactccaccatgtcagcggatgggcggaatggtctcttttcggact
tttgaagattttgtcaggatctttgatgaagtgatgggctgcttctgcgattccccaccc
caaagccccacgttccctgaggcaggtcacacgtctctatacgatgaagacaaggtcccc
agggatgaaccaattcacattctgaatgtggctatcaagactgactgtgatattgaggat
gacggactggcagctatgttcagagagtttacccaacaaaacaaagctaccttggttgag
catgggatacggcgccttactttcctggttgcacaaaaggatttcagaaaacaggtcaac
tgtgaggtggatcagagatttcatagagaatttcctaaatttttcaccttccgagcgagg
gataagtttgaggaggatcgtatctatcgtcacttggaacctgccctagctttccagtta
gagctgaaccggatgagaaattttgaccttactgccattccatgtgctaatcataagatg
cacctgtatcttggggcagccaaggtggaagtgggcacagaagtgacagactacaggttc
ttcgttcgtgcaatcatcagacattctgatctggtcaccaaggaagcttcttttgaatat
ctacaaaatgaaggggagaggctgctcctagaagccatggatgagttggaagttgctttt
aataatacaaatgttcgcactgactgcaaccacatcttcctcaactttgtgcccacagtc
atcatggacccatcaaagattgaggaatctgtgcggagcatggtaatgcgctatggaagt
cggctgtggaaattacgcgtcctccaggcagaactgaaaatcaacattcgcctgacacca
actggaaaagcaattcccatccgcctcttcctgacaaacgagtctggctattacttggac
atcagcttgtacaaggaagtgactgactccaggacagcacagatcatgtttcaggcatat
ggagacaaacagggaccattgcatggaatgttaatcaacactccatatgtcaccaaagac
ctgcttcaatcaaagagattccaggcacaatccttggggacaacatacatatatgatatc
ccagagatgtttcgacagtctctgatcaaactctgggagtctatgtccactcaagcattc
cttccatcaccccctctgccttctgacatgctgacctatacggagcttgtgttggatgat
caaggtcagctggtccacatgaacaggcttccaggaggaaatgagattggcatggtagct
tggaaaatgactcttaaaagtcctgaatacccagaaggccgagatatcattgttattggg
aatgacatcacataccgaattgggtcctttgggccgcaggaggatttgctgtttcttaga
gcttctgagcttgccagggcagagggtatcccacgcatctttgtagcagccaacagtgga
gcaagaatcggactggcagaagaaattcgtcatatgtttcatgtggcctgggtagatcct
gaggatccttacaagggatacaaatatttatatctgacccctcaggattacaagagagtc
agtgctctcaactctgtccactgtgaacatgtagaggacgagggagaatccaggtacaag
ataactgatattattgggaaggaagagggacttggagcagagaaccttcgaggctctgga
atgattgctggagaatcctcattggcctatgatgagatcatcaccatcagcctggttaca
tgccgggccattgggattggggcttaccttgttcggctgggacagagaaccatccaggtt
gaaaattctcacttaattctgactggagctggggccctcaacaaagtccttgggcgggag
gtatacacctccaataaccagctcgggggcatccagatcatgcacaacaatggggtgacc
cacagcatcgtttgcgatgacttcgaaggggttttcactgtcctgcactggctgtcttac
atgcctaagagtgtgcgcagttcagttcctctcctgaactccaaggatcctatagataga
atcatcgagtttgttcccacgaaggccccatatgatcctcgatggatgctagcaggccga
cctcacccaacccagaaaggtcagtggttgagtggattttttgactatggatctttctca
gagatcatgcagccctgggcccagactgtggtggtcggcagagccaggctaggaggaata
cctgtgggagtggttgccgtagaaacccgaacagtggaactgagtatcccagctgatcct
gcaaacctggattctgaagccaagataatccagcaggctggccaggtttggttcccagac
tctgcgtttaagacctatcaggctatcaaggacttcaaccgtgaagggctgcctctgatg
gtctttgccaactggagaggcttctctggtgggatgaaagatatgtacgaccaagtgctg
aagtttggtgcttacattgtggatagcttacgggagtgctcccagccagtgctggtgtac
attcctcctcaggctgagctccgggggggctcctgggttgtgatcgaccccaccatcaac
ccccggcacatggagatgtacgctgaccgagagagcaggggatcagttctggagccagag
gggacagtagaaatcaaattccgcagaaaggatctggtgaaaaccatgcgtcgggtggac
ccagtctacattcgcttggctgagcgattgggcaccccagagctaagcccagctgagcgg
aaggaactggagaacaagttgaaggagcgggaggaattcctaattcccatttaccatcag
gtagccgtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggtgtt
attaacgatatcctggactggaaaacatcccgtactttcttctactggcggctgaggcgt
ctcctgctggaggacctggtcaaaaagaaaatccacaatgccaacccagagctgaccgat
ggccagatccaggccatgttacggcgttggtttgtagaagtggaaggaactgtgaaggcc
tacatttgggacaataacaaggatctggtggagtggctggagaagcaactgaccgaggaa
gatggcgttcgctcagtaatcgaggaaaacatcaagtatatcagcagagactacgtcctc
aagcagatccgcagcttggtacaggccaatcccgaggttgccatggactccatcgttcat
atgactcagcacatctcgcccacgcagcgagcagaagtcgtgcggatcctctccacgatg
gactccccttcaacgtag

DBGET integrated database retrieval system