KEGG   Ailuropoda melanoleuca (giant panda): 100474644Help
Entry
100474644         CDS       T01329                                 

Gene name
ACACB
Definition
(RefSeq) acetyl-CoA carboxylase beta
  KO
K01946  
acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100474644 (ACACB)
   00640 Propanoate metabolism
    100474644 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100474644 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100474644 (ACACB)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100474644 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100474644 (ACACB)
   04922 Glucagon signaling pathway
    100474644 (ACACB)
   04920 Adipocytokine signaling pathway
    100474644 (ACACB)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100474644 (ACACB)
Enzymes [BR:aml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100474644 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100474644 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2427 aa AA seqDB search
MMDSKQVTENKSEGSYIPSQEPFPASDCSGEPPQKNGDRSPLPETPNQAEPASHKGPKDA
CGQRTSRPPPHQNPRSSDDAPAVLQANGAGTEGLRTPDTNGLSSPARPQGQRTRPLSKED
EKQEHLKRQLMTSFVLGSFDDNSSDEDPSAGLFRESSRKGSRASLGTLSLEAALAVGESE
SPVPAMRPSMSGLHLVKRGRELKKVDLHRDFTVASPAEFVTRFGGDRVIEKVLIANNGIA
AVKCMRSVRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADQYVPVPGGPNNNNYAN
VELVVDIAKRIPVQAVWAGWGHASENPKLPELLRKHEIAFLGPPSEAMWALGDKIASTIV
AQTLQIPTLPWSGSGLTVEWAEEDLQRGKRITVPEDVYNQGCVKNIDEGLQMAEKIGFPL
MIKASEGGGGKGIRKAESAEDFPILFRQVQSEIPGSPVFLMKLAEHARHLEVQILADQYG
NAVSLFGRDCSIQRRHQKIIEEAPATIAISVVFEIMEQCAVRLAKTVGYVSTGTVEYLYS
QDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGVPLHRLKDIRLLYGESPWGVT
PISFDTPANPPLARGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGG
LHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLINLLETERFQNNDI
DTGWLDYLIAEKVQAEKPDIMLGVVCGALNVADAMFRTCMTDFLHSLERGQVLPAASLLN
IVDVELIYGGVKYILKVARQSLTMFVLIMNDCHIEIDAHRLSDGGLLLSYNGNSYTTYMK
EEFDSYRITIGNKTCVFEKENDPTVLRAPSAGKLLQYTVADEGHVEAGSSYAEMEVMKMI
MTLNVQESGRVKYFKRPGAMLEAGCVVARLELDDPSKVHPAKPFTGELPSQQTLPIVGEK
LHQVFHNVLENLTNVMNGYCLPEPIFSTKLKEWVQKLMMALRHPSLPLLELQEIMTSVSG
RVPAPVEKSVRRVMAQYAGNITSVLCQFPSQQIATILDCHAATLQRKAEREVFFMNTQSI
VQLVQRYRSGTRGYMKAVVLDLLRRYLRVEHHFQQAHYDKCVINLREQLKPDMSQVLDCI
FSHAQVAKKNQLVIMLIDELCGPDPSLSEELTSILNELTQLSKSEHCKVALRARQVLIAS
HLPSYELRHNQVESIFLSAIDMYGHQFCPENLKKLILSETTIFDVLPTFFYHANKVVCMA
SLEVYVRRGYIAYELNSLQHRQLPDGTCVVEFQFMLPSSHPNRMAVPISVTNPDLLRHST
ELFMDSGFSPLCQRMGAMVAFRRFEDFKRNFDEVISCFANVPQEAPLFSKACTSLYCEED
SKNPREEPIHILNVALQYADHLEDEELVPIFRTFVQSKKNILVDYGLRRITFLIAQEKEF
PKFFTFRARDEFAEDRIYRHLEPALAFQLELSRMRSFDLTAVPCANHKMHLYLGAAKVKE
GAEVTDHRFFIRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTSVRTDCNH
IFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAEVKINIRQTATGSAAPIRLFI
TNESGYYLDISLYKEVTDPRSGNIMFHSFGNKQGPQHGMLINTPYVTKDLLQAKRFQAQS
LGTTYVYDFPEMFRQALFKLWGTPDKYPKDILTYTELVLDPQGQLVEMNRLPGGNEVGMV
AFKMRFKTPEYPEGRDVIVISNDITFRIGSFGMGEDLLYLRASEMARAEGIPKIYLAANS
GACIGLAEEIKHIFQVAWVDPGDPHKGLKYLYLTPQDYTTISSLNSVHCRHIEEDGESRY
VITDIIGKDSGVGIENLRGSGMIAGESSLAYDEIVTISLVTCRAVGIGAYLVRLGQRVIQ
VENSHIILTGVSALNKVLGREVYTSNNQLGGVQIMHYNGISHITVPDDFEGVCTILEWLS
YMPKDNHSPVPIITPTDPIDREIGFFPTRVPYDPRWLLAGRPHPTLKGSWQSGFFDHGSF
KEIMAPWAQTVVTGRARLGGIPVGVIAVETRTVEVVVPADPANLDSEAKIIQQAGQVWLP
DSAYKTAQAIKDFNRERLPLMIFANWRGFSGGMKDMYDQMLKFGAYIVDSLRQYKQPVLI
YIPPSAELRGGSWVVVDSSINPLCIEMYADKESRANILEPEGTVEIKYRKKDLIKTMRRI
DPVYKKLVEQLGMSGLSDKDRKDLEGQLKAREDLLLPVYHQVAVQFADLHDSPTCLLEKG
AISDILEWKTARSFLYWRLRRLLLEDQVKQEILGASRELSHVHIQSMLRRWFVETEGAVK
AYLWDNNQVVVQWLEQHWQGGDSLRSTVRENIKCLKRDSVLKAIRGLVQDNPEVAMDCIA
YISQHVSPAERAQVLHLLSTMDGPAST
NT seq 7284 nt NT seq  +upstreamnt  +downstreamnt
atgatggactctaagcaagtcaccgagaataaatcagaagggagctatatcccaagccag
gagccctttccagcctcagactgctcaggggagccaccacagaaaaatggtgaccgcagc
cctctgccagagactcctaaccaggctgagccagcctcccacaaaggtcccaaagatgcc
tgtgggcaaagaacttccaggccacccccacaccagaacccccgttcctctgatgacgcc
cccgcagtgctccaagccaatggggcggggactgaaggcctgaggaccccggataccaat
ggcctgtcatctccagccaggcctcagggccagcgaaccagaccgctctccaaagaagac
gagaagcaggagcacctcaagaggcagctgatgaccagcttcgtcttgggctcctttgat
gacaactcgtccgatgaggaccccagtgcgggcttgttccgagagtcctcccggaagggc
agccgggccagcctggggaccctgtccctggaggccgccctggctgtaggcgagtccgag
agccccgtccccgctatgagacctagtatgtcgggacttcacctggtgaagaggggccga
gaactgaagaaggtggacctgcacagagactttaccgtggcctccccagctgagtttgtt
acgcgctttgggggggaccgggtcattgagaaggtgctcatcgccaacaatggcatcgcc
gccgtgaagtgcatgcgctccgtccgcaggtgggcctatgagatgttccgcaacgagcgg
gccatccggtttgtagtcatggtgaccccagaggacctgaaggccaatgcagagtatatc
aagatggcagatcagtatgtccctgtcccaggagggcccaacaacaacaattatgccaac
gtggagctggttgtggacattgccaagagaatccccgtgcaggcggtgtgggctggctgg
ggccatgcttctgaaaaccccaaactgccggagctcctgcgcaagcatgagatcgctttc
ttaggccctcccagtgaggccatgtgggccttgggagataagatcgcctccaccattgtg
gcccagacgctgcagatcccaacactgccctggagtggaagcggtctgacggtggaatgg
gcagaagaggatttgcagcgggggaagagaatcactgtcccagaagatgtttacaaccag
ggttgtgtgaaaaatatagatgagggcttacagatggcagaaaaaattggttttcccttg
atgatcaaagcatctgaaggcggcggagggaaaggaatccggaaggcagagagtgccgag
gacttcccaatccttttcagacaagtgcagagtgagatccccggctcccccgtcttcctc
atgaagctagccgagcacgcccgacacctggaggtccagatcctcgccgaccagtatggg
aacgccgtgtccctgttcgggcgtgactgctccatccagcggcggcatcagaagatcatt
gaggaggcgccggccaccatcgccatatcggttgtgttcgagatcatggagcagtgtgcc
gtccgcctggccaagacggtgggctacgtgagcacggggacggtggagtatctctatagc
caggacggcagcttccacttcttggagctgaatccccgcctgcaggtggagcacccctgc
acagagatgatcgccgacgtcaacctgccggccgcccagttacagattgctatgggggtg
cccctgcaccggctgaaggatatccggcttctgtatggagagtcgccgtggggggtgaca
cccatttctttcgacactcctgccaaccctccgctcgcccgaggccatgtcatcgcggct
agaatcaccagtgagaaccccgatgaggggtttaagccaagctctggaacggttcaggag
ctgaatttccggagcaacaagaacgtgtggggttatttcagcgtagcggctgccggcggc
ttacacgagtttgctgattcccagttcgggcactgcttctcctggggagagaaccgggaa
gaggccatttcgaacatggtggtggctttgaaggagctgtccatccggggcgacttcaga
accaccgtggagtatctcattaacctgctggagactgagcgcttccagaacaatgacatc
gacacaggctggttggattacctcatcgccgagaaagtgcaggcggagaagccggatatc
atgctcggggtggtgtgcggagccttgaacgtggccgatgcgatgttcagaacttgcatg
acggatttcttacactcgctggaaaggggccaggtccttcctgcagcttctctgctgaac
atcgtggatgtggaattaatttatggaggtgttaagtacattctcaaggtggcccggcaa
tctctgaccatgttcgtcctcatcatgaacgactgtcacatcgagatcgacgcccaccgg
ctaagcgacggggggttgctgctgtcctataatggtaacagctataccacctacatgaaa
gaagagtttgacagttaccgtattaccatcggcaacaagacgtgtgtgtttgagaaagag
aacgatcccacggtcctgagagccccttcggctgggaagctgcttcagtacacggtggcg
gacgagggccacgttgaggctgggagcagctacgctgagatggaggtgatgaagatgatc
atgaccttgaacgtgcaggaaagtggccgggtgaagtactttaagcgcccgggggccatg
ctggaggcaggctgtgtggtggccaggctggagctcgatgacccttccaaagtgcacccg
gccaagccattcacaggagagctcccttcccagcaaactctgcccatcgtgggagagaaa
ctgcaccaggttttccacaatgtcctggaaaacctgaccaacgtcatgaatggctactgt
ctgccggagcctatttttagcacaaagctgaaggagtgggtacagaagctcatgatggcc
ctccgacacccgtcgctgccgctgctggagctgcaggagatcatgaccagtgtgtccggc
cgcgtccccgcccccgtggagaagtcggtccgcagggtgatggctcagtacgccggcaac
atcacctcggtgctgtgccagttccccagccagcagatagccaccatcctggactgccat
gcggccaccctgcagcggaaggctgaacgggaggtcttcttcatgaacacccagagcatt
gtgcagctggtccagaggtaccgcagcgggacccgcggctacatgaaggcggtggtgttg
gacctcctgcggagatacttgcgggtggagcatcatttccagcaagctcactacgacaag
tgcgtgataaacctcagggagcagctgaagccagacatgtcccaggtgctggactgcatc
ttctcccacgcgcaggtggccaagaagaaccagctggtgatcatgttgattgatgagctc
tgtggcccagacccttccctgtcagaagagctgacctccatcctcaacgagctcactcag
ctgagcaaaagcgagcattgcaaagtggccctcagagccagacaggtcctgatcgcctcc
caccttccgtcctacgagctgaggcacaaccaggtggagtccattttcctgtctgccatc
gacatgtatggccaccagttctgcccagaaaacctcaagaaattaatactctcagaaaca
accatatttgatgtcctgcccactttcttctaccacgctaacaaagtcgtctgcatggca
tccttggaggtttacgtgcggaggggctatatcgcctatgagttaaacagcttgcagcac
cggcagctcccagacggcacctgcgtggtggaattccagttcatgctgccctcctcccac
ccaaacaggatggccgtgcccatcagcgtcaccaaccccgacctgctgaggcacagcacc
gagctcttcatggacagcggcttctccccactgtgccagcggatgggggccatggtcgct
ttcaggagatttgaggacttcaaaaggaacttcgacgaggtcatctcctgctttgccaat
gtgccccaggaagcccccctcttcagcaaggcctgcacttccctgtactgtgaggaagac
agcaagaaccccagagaagagccgatccacatcctgaatgtggccctccagtacgcggac
cacctggaagatgaggagctggtgccgattttccgcacgttcgtacagtccaagaaaaac
atccttgtggattacggactccgaagaatcacattcctgattgcccaagagaaagaattt
cccaagtttttcacgttcagagcaagagacgagttcgcggaagatcgcatttaccgtcac
ctggagcccgccctggccttccagctggagctcagccgcatgcgcagctttgacctgacc
gccgtgccctgcgccaaccacaagatgcacctttacctgggcgccgccaaagtgaaggag
ggcgcggaagtgacggaccaccgcttcttcatccgcgccatcatccgccactcagacctc
gttacaaaggaagcctcctttgagtacctgcagaacgagggtgagcgtctgctcctggag
gccatggacgagctggaggtggcattcaacaacacgagcgtacgcaccgactgcaaccac
atcttcctgaacttcgtgcccaccgtcatcatggacccctccaagatcgaagagtccgtg
cgttccatggttatgcgctatggcagccggctgtggaaactccgggtgctgcaggctgag
gtcaagatcaacatccgccagaccgccactggcagcgctgctcccatccgcctgttcatc
accaatgagtcgggttactacctggacatcagcctctacaaagaagtcaccgaccccaga
tccggaaacatcatgtttcactcctttggcaacaagcagggaccccagcacgggatgcta
atcaacaccccgtatgtcaccaaggatctgctgcaggccaagcggttccaggcccagtcc
ctgggcaccacctacgtctacgacttcccggagatgttcaggcaggctctctttaaattg
tggggcaccccggacaagtaccccaaagacatcctgacatatacggaactcgtgctggac
cctcagggccagctcgtggagatgaaccgccttcctggaggaaatgaggtgggcatggtg
gccttcaaaatgaggttcaagaccccagaatatccggaaggacgggatgtgatcgtcatc
agcaatgacatcacgttccgcattggatcctttggcatgggagaagacctcttgtacctg
cgggcctctgagatggcccgggcagagggtatccccaaaatctacctcgcagccaacagc
ggggcctgtatcggccttgcagaggagatcaagcacatattccaggtggcttgggtggac
ccaggagacccccacaaaggacttaagtacttgtacctgacgccccaagactacaccaca
atcagctccctgaactctgtccattgtagacacatcgaggaagacggggaatccaggtat
gtcatcacggatatcatcgggaaggacagtggtgtgggcatagagaatctcaggggctcc
ggcatgatcgcaggggagtcctccctggcttacgacgagattgtcaccatcagcttggtg
acttgccgagccgtggggatcggggcctacttggtgaggctgggtcagcgagtgatccag
gtggagaactctcacatcatcctgacgggagtcagcgctctcaacaaggtgctgggcaga
gaggtctacacgtccaacaaccagctgggcggcgtgcagatcatgcattacaatggcatc
tcccacatcactgtgccagatgacttcgagggcgtttgtaccatcctggagtggctgtcc
tatatgccaaaggataatcacagcccagtccccatcatcacacccacggaccccattgac
agagaaattggattcttcccgacccgggttccctatgacccccggtggctgctggcagga
aggcctcacccgactctgaagggatcctggcagagtggattctttgaccatggcagtttc
aaggaaatcatggcgccctgggcccagaccgtggtgacaggacgagcaaggctagggggg
atccctgttggcgtgattgccgtggagacgcggaccgtggaggtggtggtgcctgcggac
cctgccaacctggactcagaggccaagataatccagcaggccggccaggtgtggctccca
gactccgcctacaagacggcccaggccatcaaggatttcaaccgagagaggttgcccctg
atgatctttgccaactggagggggttctccggtggcatgaaagacatgtacgaccagatg
ctgaagttcggagcctacatcgtggacagtctcaggcagtacaaacagcctgtcctcatc
tacatcccaccctccgcggagctccgggggggctcctgggtggtcgtggactcctccatc
aaccccctgtgcatagaaatgtacgcggacaaggagagcagggcgaatattctggagccg
gagggaacggtggagattaagtaccgaaagaaagatctgataaagaccatgagaaggatc
gacccagtttacaagaagctcgtggaacagctaggaatgtcggggctctccgacaaggac
cgcaaggacctggagggccagctgaaggcccgggaggacctgctgctgcccgtctaccac
caggtggcggtgcagttcgccgacctccacgacagccccacctgcctgctggagaagggt
gccatctccgacatcctggagtggaagactgcgcgctccttcctgtactggcgcctgcgc
cgcctcctgctggaggaccaggtcaagcaggagatcctgggggccagcagggagctgagc
cacgtgcacatccagtccatgctgcgccgctggttcgtggagacggagggcgccgtcaag
gcctacctgtgggacaacaaccaggtggtggtgcagtggctggaacagcactggcagggg
ggggacagcctgcgctccaccgtccgcgagaacatcaagtgcttgaagcgagactccgtc
ctcaaggccatcagaggcctggttcaggacaaccctgaagtggccatggactgcatcgca
tacataagccagcacgtcagcccagccgagcgggcccaagtccttcacctcctgtccacc
atggatggcccagcctccacctga

DBGET integrated database retrieval system