KEGG   Ailuropoda melanoleuca (giant panda): 100474810Help
Entry
100474810         CDS       T01329                                 

Definition
ubiquitin carboxyl-terminal hydrolase 5-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100474810
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100474810
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100474810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 858 aa AA seqDB search
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVEK
HFNKTGQRVYLHLRRTRRPKEEDTTTSTGDPPRKKPTRLAIGMEGGFDLSEEKFEYDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FNLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYREM
GYPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESSVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPAPESGDGEQVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKLPLPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVSTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
ADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVAS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgagtgaggaggcgctgctgtcagtattaccgacgatccgggttcctaag
gctggagaccgggtccacaaagacgagtgcgccttctccttcgacacaccggagtctgag
ggtggcctctacatctgcatgaacacattcctgggctttgggaaacagtatgtggagaaa
catttcaacaagacgggccagcgagtctacctgcacctccggaggacccggcgcccgaag
gaggaggacaccactacaagcactggagaccccccccgtaagaagcccacccggttggct
attggcatggaaggcgggtttgacctcagcgaggagaagtttgaatatgatgaggatgtg
aagattgttattttgccggattacctggaaattgcccgggatgggttggggggactgcct
gacattgtcagagatcgggtgaccagtgcggtggaggccctcctgtctgctgactcggcc
tcccgcaagcaggaggtgcaggcctgggatggggaagtacggcaggtgtctaagcatgcc
ttcaacctcaagcagctggacaaccctgctcgaatcccgccttgtggctggaaatgttcc
aagtgtgacatgagagagaacctgtggctcaacctgacagatggctccattctctgtggc
cgacgctactttgatggcagtgggggcaacaaccatgccgtggagcactacagggagatg
ggctacccattagctgtcaagctgggcaccatcacacccgatggagctgacgtgtactcc
tatgatgaggatgacatggtcctggaccccaacctggctgagcacctgtcccactttggc
atcgacatgctaaagatgcagaagacggacaagacgatgacggagctggagatcgatatg
aaccagcggattggcgaatgggagctgatccaggagtcgagtgtgccactgaagcccctg
tttgggcctggctacacgggcatccggaacctgggtaacagctgctacctcaactcagtg
gtccaggtgctcttcagcatccccgacttccagaggaagtatgtggataagctggagaag
atcttccagaatgctccgacggaccctacccaggacttcagcacccaggtggccaaactg
ggccatggcctgctctcgggagaatattccaagccagcaccggaatcaggcgatggggag
caggtgccagaacaaaaggaagttcaagatggcattgcccctcggatgttcaaggccctc
attggcaagggtcaccctgagttctccaccaaccgacagcaggacgcccaagagttcttt
cttcacctcatcaacatggtggagaggaattgtcggagctctgaaaatcctaacgaggtg
ttccgcttcttggtggaggaaaagatcaagtgcctggccacggagaaggtgaagtacacc
cagcgagtggactacatcatgcagctgcctgtgcccatggatgcggcccttaacaaagag
gagcttctggagtatgaggagaagaagcggcaagccgaggaggagaagctgccgctgcca
gaactggttcgggcccaggtgcccttcagctcctgcctggaggcctacggggccccggag
caggtggacgacttctggagcactgccctacaggccaaatcagtagctgtcaagaccaca
cgatttgcctctttccctgactacctggtcatccagatcaagaagttcaccttcggctta
gactgggtgcctaagaaactggatgtgtccattgaaatgccggaggagctagacatctcc
cagctgaggggtacagggctgcagcctggagaggaggagctgcctgacattgccccaccc
ctggtcactccggatgagcccaaaggtagccttggtttctatggcaacgaagacgaagac
tccttctgctcccctcacttctcctctccgacatcacccatgctggatgaatcagtcatc
atccagctggtggagatgggcttccctatggatgcctgccgcaaagctgtctactacacg
ggcaacagtggggccgaggccgccatgaactgggtcatgtcacacatggacgatccagat
tttgcaaaccccctcatcctgcctggctccagcgggcccggctccacgagtgcagcggct
gaccccccaccggaggactgcgtgagcaccatcgtttccatgggcttctcccgggaccag
gccctgaaagctcttcgggccacgaacaatagtttagaaagggccgtggactggatcttc
agtcacatcgatgacctggatgcagaggccgccatggacatctccgagggccgctcggct
gccgactccatctccgagtctgtgccagtaggaccgaaagtccgggatggccctggaaag
tatcagctctttgccttcatcagtcacatgggcacctccaccatgtgtggtcactatgtc
tgccacatcaagaaggaaggcagatgggtgatctacaatgaccagaaggtgtgtgcctct
gagaagccacctaaggacctgggctacatctacttctaccagcgagtggccagctaa

DBGET integrated database retrieval system