KEGG   Ailuropoda melanoleuca (giant panda): 100474858Help
Entry
100474858         CDS       T01329                                 

Definition
olfactory receptor 4P4-like
Orthology
K04257  
olfactory receptor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    100474858
G protein-coupled receptors [BR:aml04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    100474858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 308 aa AA seqDB search
MGHENITEFILLGLFRDEDAKVACFVVVSLCHIVTLSGNLFILLTIRGSRLREQPMYFFL
SYLSFMDVCFTSTVAPKLITDLLAQQKTISYNSCIAQMFFAHFFGATEMFILVSMAYDRY
AAICRPLHYMVIMSRQVCYVLLMASILGAFIHSILQVLIIIELPFCGPNQIDHYFCDIFP
LLKLACMDTSLLIIVIITTTGVLSILTFVALVISYIIILSTLRTRSSQGCCKALSTCGSH
ITVVFMFFLPLIFTYVPTADSVSNDKVFALFYTMIAPMFNPFIYTLRNTDMKNAMRKMWC
RDTRSEGK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggacatgaaaacatcacagagtttatcctccttggactcttccgtgatgaggatgca
aaggttgcctgctttgtggtggtctcactttgccacattgtgactctctcaggaaacctg
ttcatcctcctcaccatcaggggaagccgcctccgtgaacagcccatgtactttttcctg
agctacctgtctttcatggatgtctgcttcacttccacggtggcccccaaactgatcaca
gacctactggcccagcagaagaccatctcctacaacagctgcatagcccagatgttcttt
gcccacttctttggtgccactgagatgttcatcttggtgtccatggcctatgaccgttat
gcagccatctgcagaccccttcactatatggtcatcatgagcagacaggtgtgctatgtc
cttctgatggcctcgattctgggagcatttatccattcaatccttcaggtattgattatc
attgaacttcccttctgtggccccaatcagatagatcactatttctgtgatattttcccc
ttgctgaagctggcctgcatggacactagcttgttgattattgtgatcattaccaccact
ggagtattgtccattttgacctttgttgccttggtgatttcttacatcatcatcctgtcc
accctgaggacccggtcgtcccagggctgctgcaaagccctctccacctgtggctcacac
atcactgtcgtgttcatgttcttcctgccgctcatcttcacgtatgtccccacggctgat
tccgtcagtaatgacaaagtttttgccctattttacaccatgattgcccccatgttcaac
cctttcatctacacgctgagaaacacagacatgaagaatgccatgaggaaaatgtggtgc
cgggacacacggtctgaagggaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system