KEGG   Ailuropoda melanoleuca (giant panda): 100474987Help
Entry
100474987         CDS       T01329                                 

Gene name
PGAM2
Definition
(RefSeq) phosphoglycerate mutase 2
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00010  Glycolysis / Gluconeogenesis
aml00260  Glycine, serine and threonine metabolism
aml01100  Metabolic pathways
aml01200  Carbon metabolism
aml01230  Biosynthesis of amino acids
aml04922  Glucagon signaling pathway
aml05230  Central carbon metabolism in cancer
Module
aml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aml_M00002  Glycolysis, core module involving three-carbon compounds
aml_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100474987 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100474987 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100474987 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100474987 (PGAM2)
Enzymes [BR:aml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100474987 (PGAM2)
Membrane trafficking [BR:aml04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100474987 (PGAM2)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100474987 (PGAM2)
  Exosomal proteins of melanoma cells
   100474987 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 100474987
NCBI-ProteinID: XP_002924068
Ensembl: ENSAMEG00000017522
UniProt: D2HNN1
Position
Un
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESSWNQENRFCGWFDAELSEKGAQEAKRGAQAIKDAKMEFDICYTSVL
KRAIRTLWTILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIAPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDQALKPTKPMRFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccgccttgtgatggttcgacacggcgagagctcctggaatcaggagaac
cgcttctgtggctggttcgacgccgagctgagcgagaagggggcccaggaggccaagcgg
ggcgcccaggccatcaaggacgccaagatggagttcgacatctgctacacgtcggtgctg
aagcgggccatccgcaccctctggaccatcctggacggcacggaccagatgtggctgccc
gtggtgcgcacctggcgcctcaacgagaggcactacgggggcctcaccggcctcaacaag
gccgagacggccgccaagcacggggaggagcaggtgaagatctggagacgctctttcgac
atcccgccgccccccatggatgagaagcacccctactacaactccatcagcaaggagcgt
cggtacgcaggcctgaagcccggggaactgcccacttgcgagagcctcaaggacaccatc
gcccgggccctacccttctggaacgaggagattgccccccagatcaaggctggcaaaaga
gtgctcatcgcggcccatgggaacagtctgcggggcatcgtcaaacacctggaagggatg
tcagaccaggccatcatggagctgaacctgcccacggggatccccatcgtgtacgagctg
gaccaggcgctgaagcccaccaagcccatgcggttcctgggtgatgaggaaactgtgcgg
aaggccatggaggctgtggccgcccagggcaaggccaagtga

DBGET integrated database retrieval system