KEGG   Ailuropoda melanoleuca (giant panda): 100474987Help
Entry
100474987         CDS       T01329                                 

Definition
phosphoglycerate mutase 2-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100474987
   01230 Biosynthesis of amino acids
    100474987
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100474987
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100474987
Enzymes [BR:aml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100474987
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100474987
  Exosomal proteins of melanoma cells
   100474987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESSWNQENRFCGWFDAELSEKGAQEAKRGAQAIKDAKMEFDICYTSVL
KRAIRTLWTILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIAPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDQALKPTKPMRFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccgccttgtgatggttcgacacggcgagagctcctggaatcaggagaac
cgcttctgtggctggttcgacgccgagctgagcgagaagggggcccaggaggccaagcgg
ggcgcccaggccatcaaggacgccaagatggagttcgacatctgctacacgtcggtgctg
aagcgggccatccgcaccctctggaccatcctggacggcacggaccagatgtggctgccc
gtggtgcgcacctggcgcctcaacgagaggcactacgggggcctcaccggcctcaacaag
gccgagacggccgccaagcacggggaggagcaggtgaagatctggagacgctctttcgac
atcccgccgccccccatggatgagaagcacccctactacaactccatcagcaaggagcgt
cggtacgcaggcctgaagcccggggaactgcccacttgcgagagcctcaaggacaccatc
gcccgggccctacccttctggaacgaggagattgccccccagatcaaggctggcaaaaga
gtgctcatcgcggcccatgggaacagtctgcggggcatcgtcaaacacctggaagggatg
tcagaccaggccatcatggagctgaacctgcccacggggatccccatcgtgtacgagctg
gaccaggcgctgaagcccaccaagcccatgcggttcctgggtgatgaggaaactgtgcgg
aaggccatggaggctgtggccgcccagggcaaggccaagtga

DBGET integrated database retrieval system