KEGG   Ailuropoda melanoleuca (giant panda): 100474998Help
Entry
100474998         CDS       T01329                                 

Definition
angiopoietin-1 receptor-like
Orthology
K05121  
endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Rheumatoid arthritis
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:aml04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:aml04015]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:aml04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:aml05323]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1125 aa AA seqDB search
MDSLAGLVLCGVSLLLSGTVDSAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDRGDNVNISFKKVLTKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNRVCTECKNNGVCHEDTGEC
ICPPGFMGKTCEKACELHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCAAGWQGLQCNE
ACQPGYYGPDCKLSCRCTHGELCDRFQGCLCSPERQGLQCENEGTPRMVPQIEDLPDHIE
VNSGKFNPICKASGWPLPANEEMTLVKPDGTVLHPKDFNLTSHLSVATFTIHRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWRHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLILLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQMNSDQQNIKVPGNLTS
VLLNNLHPREQYIVRARVNTKAQGEWSEDLIAWTLSDILPPQPENIKISNITDSSAMISW
TILDGYSISSIIIRYKVQGKDEDQHIDVKIKNATITQYQLKGLEPETAYQVDIFAENNIG
SSNPTFSHELMTLSKSQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIMLQLKRANVQR
RMAQAFQNVREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVL
KARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLY
LAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQ
FIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNS
DVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKP
YERPSFAQILVSLNRMLEERKTYVNTTLYEKFAYAGIDCSAEEAA
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atggactctttagccggcttagttctctgtggagtcagcttgctcctttctggaacagtg
gacagtgccatggacctgatcttgatcaattccctacctctcgtgtctgatgcagaaaca
tccctcacctgcatcgcctctggctggcgcccccatgagcccatcactataggaagggac
tttgaagccttaatgaaccagcaccaggatccactggaagttactcaagatgtgaccaga
gaatgggctaaaaaagtcgtttggaagagagaaaaggctagtaaaatcaatggtgcatat
ttctgtgaagggcgcgttcggggagaagcaataaggatccggaccatgaagatgcgacag
caagcttccttcctaccagctactttaaccatgactgtggacaggggagataatgtgaac
atatctttcaaaaaggtgttgactaaagaagaagatgcagtgatttacaaaaacggttcc
ttcatccactcagtgccccggcacgaagtacctgatattttagaagtgcatctgcctcac
gctcagccccaggatgctggcgtgtactcagccaggtacataggaggaaacctcttcacc
tcggccttcaccaggctgatagtccgcagatgtgaagctcagaagtggggacctgaatgt
aaccgcgtctgtactgagtgtaagaacaatggtgtctgccatgaagatacaggagaatgc
atttgcccacctgggtttatgggaaagacctgtgagaaggcttgtgagctgcacacattt
ggcagaacttgtaaagaaaggtgtagtggaccagagggatgcaagtcgtatgtgttctgt
ctcccagacccctacgggtgctcctgtgccgcaggttggcagggtctgcagtgcaacgaa
gcgtgccagccgggttattacgggccggactgtaagcttagttgcaggtgcacccatggg
gagctgtgtgaccgattccaaggatgtctctgctctccagaacgccaagggctccagtgt
gagaatgaaggcacgccaaggatggtcccacaaatagaggatttgccagatcacatagaa
gtaaacagcggtaaatttaaccccatctgcaaagcgtctggctggccactacctgccaat
gaagaaatgactctcgtgaagccggatgggacagtgctgcatccaaaagacttcaacctc
acgagtcatctgtcagtggccacattcaccatccaccggatcctcccccctgactcagga
gtctgggtctgtagcgtgaacactgtggctgggatggtggaaaagcctttcaacatctct
gttaaagttcttccaaagcccctgaatgccccaaacgtgattgacactggacataatttt
gctgtcatcaacatcagctctgagccttactttggcgatggaccaatcaaatccaagaag
cttctatacaaacctgttaatcattatgaggcgtggcggcatattcaagtgacaaatgag
attgttacactcaactatttggaacctcgcacagaatacgagctctgcgtgcagctggtc
cggcgtggagagggcggggaagggcatccaggacccgtgagacggttcacaactgcttct
atcggtctccctcctccaagaggtctcatcctcctaccaaaaagtcagaccactctaaat
ttgacctggcaaccaatatttccaagctcggaagatgacttctatgttgaagtggagaga
aggtctgtacaaatgaatagtgaccagcagaatatcaaagtgccaggcaacctgacttca
gtgctgctcaacaacttacaccccagggagcagtacatagtccgagccagagtgaacacc
aaggcccagggggaatggagtgaagatctcattgcttggacccttagcgacattctccct
cctcaaccagaaaatatcaagatttctaacatcacagactcctcagccatgatctcttgg
acaatcttggatggctattctatttcttctattatcatccgttataaggttcagggcaag
gatgaagaccagcacattgacgtgaagatcaagaatgccaccattacccagtatcagctc
aagggtctagagcctgaaacagcttaccaggtggacatttttgcagagaacaacataggg
tcaagcaacccaaccttttctcatgaactgatgaccctttctaaatctcaagcaccagcg
gaccttggaggtgggaagatgctgcttatagccatccttggttctgcaggaatgacctgc
ctgacggtgctgttggccttccttatcatgttgcagttgaagagggcaaatgtccaaagg
agaatggcccaagctttccaaaacgtgagggaagaaccagctgtgcagttcaactcagga
actctggccctgaacaggaaggccaaaaacaacccggatcctacaatttatccagtgctt
gactggaatgacatcaaatttcaagatgtgatcggggagggtaattttggccaggttctt
aaggcgcgcatcaagaaggatgggttacggatggacgctgccatcaagaggatgaaagaa
tatgcctccaaagatgaccacagggacttcgctggggaactggaagttctctgtaaactt
ggccaccacccaaacatcatcaatctcttgggagcgtgtgaacatcgtggctacctgtac
ctggccatcgaatacgccccccatggaaacctcctggacttcctgcgcaagagccgagtg
ctggagaccgatccggcattcgccatcgccaacagcaccgcctccacactgtcctcccag
cagctcctccatttcgcagcagacgtggcccggggtatggactacttgagccagaaacag
tttattcacagggatctggctgccaggaacattttagttggtgaaaactatgtagccaaa
atagcagattttggactatcccgaggtcaagaagtatatgtgaaaaagacgatgggaagg
ctcccggtgcgctggatggcaatcgagtcactaaattacagtgtgtatacaaccaacagt
gacgtatggtcctatggagtgttactatgggagatcgttagcttaggtggcaccccctac
tgcgggatgacatgtgcggaactgtacgagaagctgccccagggctacagactggagaag
cccttgaactgtgatgacgaggtgtatgacctcatgaggcagtgctggcgggagaagcct
tatgagaggccctcgtttgcccagatcctggtgtccttaaacaggatgctagaggaacgc
aagacctacgtgaataccacgctttatgagaagtttgcctatgccgggattgactgctct
gcagaagaagcagcttag

DBGET integrated database retrieval system