KEGG   Ailuropoda melanoleuca (giant panda): 100475022Help
Entry
100475022         CDS       T01329                                 

Definition
tyrosinase-like
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100475022
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100475022
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100475022
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100475022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 345 aa AA seqDB search
MLLTALCCLLWSFRTSTGHFPRDCASSKSLIEKECCPPWRGDGSPCGQLSGRGVCQDIVL
SNAPLGPQFPFTGVDDRESWPSVFYNRTCQCFGNFMGFNCGNCKFGFWGPNCTEKRLLVR
KNIFDLSVPEKNKFLAYLTLAKHTISPDYVIPTGTYGQMNNGSTPMFNDINIYDLFVWMH
YYVSRDTLLGGSQIWRDIDFAHEAPGFLPWHRLFLLLWEQEIQKLTGDENFTIPYWDWRD
AKSCDICTDEYMGGRNPANPNLLSPASFFSSWQIICTRLEEYNSQQALCDGTPEGPLLRN
PGNHDKARTPRLPSSADVEFCLNLTQYESDSMDKAANFSFRNTLE
NT seq 1036 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgactgctctgtgctgcctgctgtggagtttccggacctccactggccatttc
cctcgagactgtgcctcttccaagagcctgatagagaaggaatgctgcccaccatggagg
ggtgacgggagtccctgtggccagctttcgggtaggggtgtctgtcaggacatcgttctg
tccaatgcccccctcgggcctcaattccccttcacaggggtggatgacagggaatcttgg
ccctcagtcttttacaataggacctgccagtgctttggcaacttcatgggattcaactgt
ggaaattgcaagtttggcttttggggaccaaactgcacagagaagcgacttctggtgaga
aaaaacatctttgatctgagtgtcccagagaagaacaaatttcttgcctaccttacttta
gcgaagcataccatcagcccagactatgtcatccccacaggcacctatggccaaatgaat
aatggatcaacacccatgtttaatgacatcaacatttatgacctctttgtctggatgcat
tattatgtgtcaagggacacactgctcggagggtctcaaatctggagagacattgatttt
gctcatgaagcccctggtttcctgccttggcacagactcttcttgttgctgtgggaacaa
gaaatccagaagctgactggggatgagaacttcactattccatactgggattggcgagat
gctaaaagctgtgacatttgcacagatgagtacatgggagggcgcaacccagcaaaccct
aacttactcagcccagcatccttcttctcctcttggcagatcatctgcacccgcctggag
gagtacaacagccagcaggctttatgcgacggaactccagagggaccactactgcgaaat
cctggaaaccatgacaaagccaggaccccgaggctcccctcctctgctgatgtggaattc
tgcctaaatctgacccagtatgaatcggattccatggataaagctgccaatttcagcttt
agaaatacactggaag

DBGET integrated database retrieval system