KEGG   Ailuropoda melanoleuca (giant panda): 100475060Help
Entry
100475060         CDS       T01329                                 

Definition
cysteinyl leukotriene receptor 2-like
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100475060
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100475060
G protein-coupled receptors [BR:aml04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    100475060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 345 aa AA seqDB search
MERKLMSLPPSTSIPEMEPNGTFSNNNSNGNCTIENFKKDFYPTVYLIIFVWGTLGNGFS
IYVFLQSYKKSTSVNVFMLNLAISDFLFTSTLPFRADYYLRGSNWIFGDLTCRIMSYSLY
VNMYSSIYFLTVLSIVRFLATVHPFRLLHVASIRSAWTLCGIIWILIMAAAVVLLNNGSE
RKGSAVLCLELNINKIVKLQTMNYIALVMGFLLPFCMLSICYLLIIRALLKVEVPESGLR
VSHKKALITIIIALIIFLLCFLPYHILRTLHLLVWEVDICEEKLHKAVVITLALAGANSC
LNPLLYYFAGENFKEKLRSTLKKDHLQKTKYSNLVCMCLKKETQV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaacttatgtccttgcctccatccacctccataccagaaatggaacccaat
ggcaccttcagcaataacaacagcaatgggaactgtacaattgaaaacttcaaaaaggac
ttttaccccactgtgtacctgataatatttgtctggggaaccttgggaaatggcttttcc
atatatgttttcctgcagtcttataagaagtccacatctgtgaatgttttcatgctaaac
ctggccatttcagatttcttattcacaagtacactacccttcagagctgactattacctc
agaggctccaattggatatttggggacctgacctgcaggattatgtcttattctctgtat
gtcaacatgtacagcagcatttatttcctgactgtgctgagcattgtgcgtttcctggca
actgttcaccccttccggctcctccacgttgccagcatccggagtgcctggactctgtgt
gggatcatatggatccttatcatggctgccgcagtagtgcttctgaacaatggctctgag
cggaagggcagtgccgtattgtgcttagagctgaatatcaacaaaattgttaaactgcag
accatgaactacatcgccttggtgatgggcttcctgctgccgttctgcatgctcagcatt
tgttacctgctgatcattcgagctctgttaaaggtggaggtcccagaatcgggtctgcgg
gtttctcacaagaaggcacttatcaccatcatcattgccttgatcatcttcctcctgtgt
ttcctgccctatcacatactgagaaccctccacctgcttgtgtgggaagtggatatatgc
gaagagaagctgcataaagctgtggtcatcacactggccctggcaggagccaatagctgc
ctcaatcctttgctctactacttcgctggggaaaattttaaggaaaaactaaggtctacg
ctcaaaaaagatcacctacagaagacaaagtacagcaatcttgtctgcatgtgtttgaaa
aaggaaacacaagtttaa

DBGET integrated database retrieval system