KEGG   Ailuropoda melanoleuca (giant panda): 100475095Help
Entry
100475095         CDS       T01329                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100475095
  Lipid metabolism
   00062 Fatty acid elongation
    100475095
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100475095
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100475095
Lipid biosynthesis proteins [BR:aml01004]
 Fatty acid synthase
  Component type
   100475095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 306 aa AA seqDB search
MASPSFLWLLAVALLPGSCAAPALGHLDPAAPLPLVIWHGMGDSCCNPLSMGAIKKMVEK
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQILAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISVGGQHQGVYGLPRCPGESSHICDLIRKTLNAGAYNKAIQERL
VQAEYWHDPLKEDVYRNHSIFLADINQERGVNESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETTLYTQDRLGLKEMDNAGQLVFLAVEGDHLQLSQEWFYAH
IIPFLD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccagcttcttgtggctcttggccgtcgctctcctgccggggtcctgcgct
gcaccggcgctggggcatctcgacccggccgcgccgctgccgctggtgatctggcatggg
atgggagacagctgttgtaatcccttaagcatgggtgctattaaaaaaatggttgagaag
aaaatacctggaatttatgtcttatccttagagatcgggaagaccctgatggaggatgtg
gagaacagcttcttcttgaatgtcaattcccaagtaacaacagtgtgtcagattcttgct
aaggatcctaaattgcagcaaggctacaatgctatgggattctcccagggaggccaattt
ctgagggccgtggctcagagatgcccatcaccgcccatgatcaatctgatctcggtcggg
ggacaacatcaaggtgtttatggactccctcggtgcccaggggagagctctcacatctgt
gacctgatcaggaaaaccctgaatgcgggggcttacaacaaagctattcaagaacgcctg
gtgcaagcggagtactggcacgaccccctcaaggaggacgtgtaccgcaaccacagcatc
ttcttggcagatattaatcaggagaggggtgtcaatgagtcctacaagaagaacctgatg
gccttgaagaagtttgtgatggtgaaatttctcaatgattccatcgtggaccctgtggac
tctgagtggttcggattttatagaagtggccaagccaaggaaaccatccccttgcaggag
accactctgtacacacaggaccgcctggggctaaaggaaatggacaatgcaggacagtta
gtgttcctggcggtagaaggggaccatcttcagctgtctcaagaatggttttatgcccac
atcatacccttccttgactga

DBGET integrated database retrieval system