KEGG   Ailuropoda melanoleuca (giant panda): 100475095Help
Entry
100475095         CDS       T01329                                 

Gene name
PPT1
Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00062  Fatty acid elongation
aml01100  Metabolic pathways
aml01212  Fatty acid metabolism
aml04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    100475095 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100475095 (PPT1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100475095 (PPT1)
Lipid biosynthesis proteins [BR:aml01004]
 Fatty acid synthase
  Component type
   100475095 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Glyco_hydro_98M
Motif
Other DBs
NCBI-GeneID: 100475095
NCBI-ProteinID: XP_002927605
Ensembl: ENSAMEG00000004444
Position
Un
AA seq 306 aa AA seqDB search
MASPSFLWLLAVALLPGSCAAPALGHLDPAAPLPLVIWHGMGDSCCNPLSMGAIKKMVEK
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQILAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISVGGQHQGVYGLPRCPGESSHICDLIRKTLNAGAYNKAIQERL
VQAEYWHDPLKEDVYRNHSIFLADINQERGVNESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETTLYTQDRLGLKEMDNAGQLVFLAVEGDHLQLSQEWFYAH
IIPFLD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccagcttcttgtggctcttggccgtcgctctcctgccggggtcctgcgct
gcaccggcgctggggcatctcgacccggccgcgccgctgccgctggtgatctggcatggg
atgggagacagctgttgtaatcccttaagcatgggtgctattaaaaaaatggttgagaag
aaaatacctggaatttatgtcttatccttagagatcgggaagaccctgatggaggatgtg
gagaacagcttcttcttgaatgtcaattcccaagtaacaacagtgtgtcagattcttgct
aaggatcctaaattgcagcaaggctacaatgctatgggattctcccagggaggccaattt
ctgagggccgtggctcagagatgcccatcaccgcccatgatcaatctgatctcggtcggg
ggacaacatcaaggtgtttatggactccctcggtgcccaggggagagctctcacatctgt
gacctgatcaggaaaaccctgaatgcgggggcttacaacaaagctattcaagaacgcctg
gtgcaagcggagtactggcacgaccccctcaaggaggacgtgtaccgcaaccacagcatc
ttcttggcagatattaatcaggagaggggtgtcaatgagtcctacaagaagaacctgatg
gccttgaagaagtttgtgatggtgaaatttctcaatgattccatcgtggaccctgtggac
tctgagtggttcggattttatagaagtggccaagccaaggaaaccatccccttgcaggag
accactctgtacacacaggaccgcctggggctaaaggaaatggacaatgcaggacagtta
gtgttcctggcggtagaaggggaccatcttcagctgtctcaagaatggttttatgcccac
atcatacccttccttgactga

DBGET integrated database retrieval system