KEGG   Ailuropoda melanoleuca (giant panda): 100475270Help
Entry
100475270         CDS       T01329                                 

Definition
dual specificity protein kinase CLK2-like
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100475270
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100475270
Spliceosome [BR:aml03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100475270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 499 aa AA seqDB search
MPHPRRYHSSERGSRGSYHEHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYD
DRSSDRRVYDRRYYGSYRRNGCSRDRGEAYCEPDYRHSYEYHREDSSYRSQRSSRRKHRR
RRRRSRTFSRSSSHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCV
DHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCI
SFELLGLSTFDFLKDNNYLPYPVHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNS
DYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQP
CDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDW
DENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFAR
LRAEPPNTKLWDSSRDISR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatccccgaaggtaccattcctcagagcgaggcagccggggcagttaccatgag
cactatcggagccgaaagcacaagagacgaagaagccgctcctggtcaagtagcagtgac
cggacccggaggcgccggcgggaagacagctaccatgtccgttcccggagcagttacgat
gaccgctcgtcggaccggagggtgtatgaccggaggtactatggcagctacaggcgcaac
ggctgcagccgggaccggggagaagcctactgtgagcctgactaccggcactcctacgaa
taccaccgggaggacagcagttaccgcagccagcgcagcagccggaggaagcacaggcgg
cggagacggcgcagccggaccttcagccgctcatcttcgcacagcagccggagagccaag
agtgtagaggacgacgctgagggccacctcatctaccacgtcggggactggctgcaagag
cgatatgaaattgtaagcactttgggagaggggacctttggccgagttgtacaatgtgtt
gaccatcgcaggggtggggctcgagttgccctgaagatcattaagaatgtggaaaagtac
aaggaagcagctcggcttgaaatcaacgtcctggagaaaatcaatgagaaggaccctgac
aataagaacctctgtgtgcagatgtttgactggtttgactaccatggccacatgtgcatc
tctttcgagcttctgggccttagcaccttcgatttcctcaaagacaacaactacctgccc
taccccgtccaccaagtgcgccacatggccttccagctgtgccaggctgtcaagttcctc
catgataacaagctgacacatacggacctcaagcctgaaaatattctgtttgtgaattca
gactatgagctcacctacaatctagagaagaaacgagatgaacgcagcgtgaagagcaca
gctgtgcgggtggtggactttggcagtgccacctttgaccacgaacaccacagtaccatt
gtctccactcgccattaccgggcaccagaggtcatcctcgagttgggctggtcacagcct
tgtgacgtgtggagcatcggctgcattatctttgagtactatgttggcttcacactgttt
cagacccatgacaacagagagcatctagccatgatggaaaggatcttgggtcctatccct
tcccggatgatccgaaagacaaggaagcagaaatatttttatcggggtcgcctggattgg
gatgagaacacatcagctgggcgctacgtacgagaaaactgcaaaccactgcggcggtat
ctgacctcagaggcagaggaacaccaccagctcttcgatctgattgaaagcatgctagag
tatgaacctgctaagcggttgaccttgggtgaagcccttcagcatcctttcttcgcccgc
cttcgggctgagccacccaacaccaagttgtgggactccagtcgggatatcagtcggtga

DBGET integrated database retrieval system