KEGG   Ailuropoda melanoleuca (giant panda): 100475381Help
Entry
100475381         CDS       T01329                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100475381
Enzymes [BR:aml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100475381
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100475381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 330 aa AA seqDB search
MQPQSVLHSGYFHPLLRTWQAAATPLSASNLIYPIFVTDVPDDVQPIDSLPGVARYGVNR
LEEMLKPLVEEGLRCVLVFGVPSRVPKDERGSAADSEDSPAIEAIRLLRKTFPSLLVACD
VCLCPYTSHGHCGLLSKNGAFQAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKE
ALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVAR
DVREGADMLMVKPGMPYLDIVREVKDKHPELPLAVYHVSGEFAMLWHGARAGAFDLKAAV
LEVMTAFRRAGADVIITYYTPQLLQWLKED
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccagtcggttctgcacagcggctacttccacccgctgcttcgcacctggcag
gcagccgccacgcccctcagtgcctccaacctcatctaccccatcttcgtcacggacgtt
cctgatgacgtacagcccatcgacagcctcccaggagtggccaggtatggcgtgaaccgg
ctggaagaaatgctgaagcccctggtggaagagggcctgcgctgtgtcctggtctttgga
gtccccagcagagtccccaaggatgagcggggttctgcagccgactccgaggactcccca
gctatcgaggccatccgcctgctacgcaagaccttccccagcctcctggtggcctgtgat
gtctgcttgtgcccctacacctctcatggtcactgtgggctcctgagcaagaatggggca
ttccaggctgaggagagccgccagcggctggcagaagtggccctggcctatgccaaggca
ggatgtcaggtggtagccccatcggacatgatggacggacgtgtggaagccatcaaggag
gctctgatggcccatggacttggcaacagggtatcagtgatgagctatagtgccaaattc
gcatcctgtttctatggacctttccgggatgcggctcagtccagcccagctttcggagac
cgccgctgctaccagctgccacccggagcacgaggcctggccctgcgagcagtggcccgg
gacgtacgggaaggagccgacatgctcatggtgaagccaggaatgccctacctggacatc
gtgcgggaggtgaaggacaagcaccctgagctccctcttgctgtgtaccatgtttctgga
gagttcgccatgctgtggcatggagcccgggccggggcgtttgatctcaaggctgctgtt
ctggaggtcatgaccgccttccgccgtgcaggtgccgacgtcatcatcacctactacacg
cctcagctgttgcagtggctgaaggaggactga

DBGET integrated database retrieval system