KEGG   Ailuropoda melanoleuca (giant panda): 100475388Help
Entry
100475388         CDS       T01329                                 

Definition
serine/threonine-protein kinase PAK 2-like
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100475388
   04010 MAPK signaling pathway
    100475388
   04012 ErbB signaling pathway
    100475388
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100475388
  Cellular commiunity
   04510 Focal adhesion
    100475388
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100475388
  Development
   04360 Axon guidance
    100475388
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    100475388
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100475388
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100475388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALSTKGSETSAVVTEEDDDDEEAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDGGAKSSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLMGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcgcctcccgtgcgaatgagcagt
accatttttagcaccggaggcaaggaccctttgtcagccaatcacagtttgaaacctttg
ccttctgttccagaggaaaaaaagcccaggaataaaatcatctctatattctcaggcaca
gagaaaggaagtaagaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgcagttactggagaattcactggcatgccagaa
cagtgggctcgattattacagacctccaatatcaccaaactagagcaaaagaagaatccg
caggctgtgctggatgtcttaaagttctatgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggcttcccttctggaacaccagcactgagtaccaag
ggatcagaaacgtcagcagtcgtgacagaggaagatgacgatgatgaagaggctgctccc
cctgttattgccccgcggccggatcacacaaaatcaatttatacacggtctgtaattgac
cctattcctgcaccagttggcgattctaatgttgatggcggtgccaagtcttctgacaaa
cagaaaaagaagaccaaaatgacagatgaagagattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatacacaagatatgaaaaaattgggcaaggggcttct
ggtacagttttcactgctactgatgtggcattgggacaggaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattaatcattaatgaaattctggtgatgaaagaa
ttaaagaatcccaacatagttaacttcttggacagttacctgatgggagatgaactgttc
gtggtaatggagtaccttgctgggggatcacttactgatgttgtaacagaaacctgcatg
gatgaagcacagattgctgctgtatgcagagagtgtttacaggcattggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaacgtgcttttggggatggaagga
tcggttaaacttactgactttgggttctgcgcccagatcacccctgagcagagcaagcga
agtaccatggttggaacgccgtactggatggccccagaggtggttacacggaaagcttat
ggccctaaagtggacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctgatagcaactaatggaact
ccagaacttcagaatccagagaaactttccccaatatttcgggatttcttaaaccgttgt
ttggagatggatgtggagaaaaggggttcggccaaagaattgttacagcatcccttcctg
aaactggccaaacccttgtccagcctgacaccactgatcatggcagctaaagaagcgatg
aagagtaatcgttag

DBGET integrated database retrieval system