KEGG   Ailuropoda melanoleuca (giant panda): 100475388Help
Entry
100475388         CDS       T01329                                 

Gene name
PAK2
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100475388 (PAK2)
   04010 MAPK signaling pathway
    100475388 (PAK2)
   04012 ErbB signaling pathway
    100475388 (PAK2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100475388 (PAK2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100475388 (PAK2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100475388 (PAK2)
  Development
   04360 Axon guidance
    100475388 (PAK2)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    100475388 (PAK2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100475388 (PAK2)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100475388 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALSTKGSETSAVVTEEDDDDEEAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDGGAKSSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLMGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcgcctcccgtgcgaatgagcagt
accatttttagcaccggaggcaaggaccctttgtcagccaatcacagtttgaaacctttg
ccttctgttccagaggaaaaaaagcccaggaataaaatcatctctatattctcaggcaca
gagaaaggaagtaagaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgcagttactggagaattcactggcatgccagaa
cagtgggctcgattattacagacctccaatatcaccaaactagagcaaaagaagaatccg
caggctgtgctggatgtcttaaagttctatgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggcttcccttctggaacaccagcactgagtaccaag
ggatcagaaacgtcagcagtcgtgacagaggaagatgacgatgatgaagaggctgctccc
cctgttattgccccgcggccggatcacacaaaatcaatttatacacggtctgtaattgac
cctattcctgcaccagttggcgattctaatgttgatggcggtgccaagtcttctgacaaa
cagaaaaagaagaccaaaatgacagatgaagagattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatacacaagatatgaaaaaattgggcaaggggcttct
ggtacagttttcactgctactgatgtggcattgggacaggaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattaatcattaatgaaattctggtgatgaaagaa
ttaaagaatcccaacatagttaacttcttggacagttacctgatgggagatgaactgttc
gtggtaatggagtaccttgctgggggatcacttactgatgttgtaacagaaacctgcatg
gatgaagcacagattgctgctgtatgcagagagtgtttacaggcattggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaacgtgcttttggggatggaagga
tcggttaaacttactgactttgggttctgcgcccagatcacccctgagcagagcaagcga
agtaccatggttggaacgccgtactggatggccccagaggtggttacacggaaagcttat
ggccctaaagtggacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctgatagcaactaatggaact
ccagaacttcagaatccagagaaactttccccaatatttcgggatttcttaaaccgttgt
ttggagatggatgtggagaaaaggggttcggccaaagaattgttacagcatcccttcctg
aaactggccaaacccttgtccagcctgacaccactgatcatggcagctaaagaagcgatg
aagagtaatcgttag

DBGET integrated database retrieval system