KEGG   Ailuropoda melanoleuca (giant panda): 100475450Help
Entry
100475450         CDS       T01329                                 

Definition
retinoic acid receptor RXR-gamma-like
Orthology
K08526  
retinoid X receptor gamma
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100475450
   03320 PPAR signaling pathway
    100475450
   04919 Thyroid hormone signaling pathway
    100475450
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100475450
   05202 Transcriptional misregulation in cancers
    100475450
   05216 Thyroid cancer
    100475450
   05222 Small cell lung cancer
    100475450
   05223 Non-small cell lung cancer
    100475450
Transcription factors [BR:aml03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100475450
Nuclear receptors [BR:aml03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100475450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
PPLNALGSPYRVITSAMGPPSGALAAPPGLNLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggaattattctcacttcatgaagtttcccacaggctttggcggctcccccggc
cactccggctccacgtccatgagcccatcggcagccttgtccacagggaagccaatggac
agccaccccagctacacggacaccccagtgagtgccccccggaccctgagtgcggtgggg
ccccccctcaatgccttgggttctccataccgagtcatcacatctgccatgggcccgccc
tcgggagcgctggctgcgcctccaggactcaatctggtcgccccgcccagctcccagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaagcccttaccagggcttcctggg
attggaaacatgaactatccatcaaccagccccggttcgctggtgaaacacatctgtgcc
atctgtggggacagatcctcaggaaagcactacggtgtatacagttgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaagacctcatgtacacgtgtcgcgataataaggac
tgcctcattgacaagcgccagaggaaccgctgtcagtactgccgttaccagaagtgcctg
gtgatgggcatgaagagggaagctgtgcaggaagaaaggcagaggagccgggagcgggcc
gagagcgaggcagaatgcgccagtagcggccatgaagatatgcctgtggagcggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgatatgaacatggagaac
tcgacgaatgaccctgtcaccaacatatgccatgctgctgacaagcagcttttcactctt
gttgaatgggccaagcgcatcccccacttctctgacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaatgagctgctgattgcctctttctcccaccgctccgtctcc
gtgcaggatggcattctcctggccacgggcttacacgtccaccggagcagcgcccacagc
gccggggtcggctccatcttcgacagggtcctgactgagctggtctccaaaatgaaagac
atgcagatggacaagtcggagctggggtgcctgcgagccatcgtgctgtttaacccagat
gccaaggggctgtccaacccctcggaggtagagactctgcgagagaaggtttatgctacc
cttgaggcctacacaaagcagaagtatccggaacaacctggcaggttcgccaagctgctg
ctgcgcctcccagccctgcgctccatcggcttgaagtgcctggagcacctgttcttcttc
aagctcattggggacacgcccatcgacaccttcctcatggagatgctggagaccccgctg
cagatcacctga

DBGET integrated database retrieval system