KEGG   Ailuropoda melanoleuca (giant panda): 100475456Help
Entry
100475456         CDS       T01329                                 

Definition
protein disulfide-isomerase TMX3-like
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100475456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 469 aa AA seqDB search
MKAPPPQLVAKPCFGFRFRLLSRQKNFYPPGVFLLDMAFCKGFVEDLDESFKDNRKDDIW
LVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKL
LKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHVQKRHRVFFVYIGGESPLK
EKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWIN
RERFQNYLTVDGFLLYELGDTGKLVAIAVIDEKNTSIEHTRLKSVIQEVARDYRDQFHRD
FQFGHMDGNDYINTLLMDELKVPTVVVLNTSNQQYFLLDRQIKNAEDMVQFINNILDGTV
EAQGGDSILQRLKRIVFDAKSTVVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGG
YIEERYEVSKSEIESQEPTEESKEQDPRSGDTLVPTVQGPKDVLEKKKD
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctccaccaccccagcttgtggccaaaccttgctttggctttaggttccgactc
ttgtcacgtcagaagaatttttacccacccggggtttttttacttgatatggctttctgt
aaaggatttgttgaagatttagatgaatcgtttaaagacaatcggaaagatgacatttgg
cttgtagatttttatgcaccatggtgtggccattgtaaaaaactggaaccaatttggaat
gaagttggtcttgagatgaaaagtattggttctccagttaaagttggaaagatggatgcc
acctcctattccagcattgcttcagagtttggagttcgaggttatccaacaattaagcta
ttaaagggggatttggcatataattatagaggaccacgaactaaagatgatattattgag
tttgctcacagagtgtctggggctctaattcggccacttccgagtcagcaaatgtttgaa
catgtgcaaaagagacatcgtgtattttttgtttacataggtggagagtcacctttgaag
gagaaatacatagatgctgcttcagaattaattgtatatacatacttcttctctgcctcg
gaagaagtggttcctgagtatgtgacactgaaggagatgcctgctgtgcttgttttcaaa
gatgaaacttactttgtttatgatgagtacgaggatggtgatctgtcatcttggatcaac
agggagaggtttcagaactacctgactgtggatggtttcctcttgtatgaacttggagac
actggaaagcttgtggctattgcagttattgatgagaaaaatacatcaattgaacatacc
agattaaaatcagttattcaggaagttgcgagagattacagagaccagttccacagggat
tttcagtttggccatatggatggaaatgactatataaataccttgctgatggatgaactg
aaagtcccaactgtggttgtactgaatacttcaaaccaacagtacttcttactagacaga
cagattaagaatgccgaggacatggtgcagttcattaataacatcttggatggcacagta
gaggcccaaggaggtgatagcattttgcagagattgaaaagaatagtatttgatgccaaa
tctactgttgtgtctatcttcaagagctctccacttatgggctgctttctcttcggcctc
ccactgggggtcatcagtatcatgtgctatggcatctacacagctgacaccgatggaggc
tatatagaagaacgatatgaagtatccaaaagtgaaattgaaagccaagaaccaacagaa
gaaagcaaagaacaggatccaaggagtggagacaccctagtgcctacagtgcaaggaccc
aaagatgtattagaaaagaaaaaagattga

DBGET integrated database retrieval system