KEGG   Ailuropoda melanoleuca (giant panda): 100475493Help
Entry
100475493         CDS       T01329                                 

Gene name
MYL7
Definition
(RefSeq) myosin, light chain 7, regulatory
  KO
K12754  
myosin regulatory light chain 7
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100475493 (MYL7)
  Cellular commiunity
   04510 Focal adhesion
    100475493 (MYL7)
   04530 Tight junction
    100475493 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100475493 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 197 aa AA seqDB search
MCMGRGESLGSRGEDLFPPTVLQASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFK
EAFSCIDQNRDGIICKSDLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKL
NGTDPEEAILSAFRMFDPSGKGVVKKDEFKQLLLTQADKFSLAEVEQMFALTPMDLAGDI
DYKSLCYIITHGDEKEE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtgcatgggaaggggggagtctttggggagccggggagaggacctcttcccaccgaca
gtgttgcaggccagcaggaaggcggggacccggggcaaggccgcggccaccaagcaggcc
cagcgaggctcttccaatgtgttttccatgttcgagcaagcccagatccaggagttcaag
gaagccttcagctgcatcgaccagaaccgcgatggcattatctgcaagtcagaccttcgg
gagacctactcccagctcgggaaggtgagcgtgccagaagaggagctggatgccatgctg
caggaggggaagggtcccatcaacttcactgtcttcctcacgctcttcggggagaagctc
aatgggacagaccccgaggaagccatcctgagcgccttccgcatgttcgaccccagcggc
aagggtgtggtgaagaaggatgagttcaagcagcttctcctgacccaggcagacaagttc
tctctggcggaggtggagcagatgttcgccctgacacccatggacttggcgggggacatt
gactacaagtctctgtgttacatcatcacccacggggacgagaaggaggagtga

DBGET integrated database retrieval system