KEGG   Ailuropoda melanoleuca (giant panda): 100475516Help
Entry
100475516         CDS       T01329                                 

Gene name
PFN3
Definition
(RefSeq) profilin 3
  KO
K05759  
profilin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100475516 (PFN3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100475516 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100475516 (PFN3)
Cytoskeleton proteins [BR:aml04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100475516 (PFN3)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100475516 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 137 aa AA seqDB search
MGDWKGYISAVLRDQRIDDVAIVGYSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL
QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI
LNKTVHELIKGLRTQGT
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggggactggaaaggctatatcagtgcggtgctgcgagaccagcgcattgacgacgta
gccatcgtgggctactcagacaatcgctgcgtgtgggcatcgcgcccaggaggccttctg
gctgccatatcaccgcaagaggtgggtgtgctcacagggcctgatcggcgcaccttcctg
caggccggcctgagcgtggcaggccgccgctgctgcgtcatccgcgaccacttgctgtct
gagggcgatggagttctggacgcacgcactaaggggctggatgggcgtgcggtctgcgtg
ggccacaccccgcgcgtgctcctcgtgctcatgggccgacggggcgtgcacggcggcatc
ctcaacaagacagtgcatgaactgatcaaggggctgcgcacacagggcacctag

DBGET integrated database retrieval system