KEGG   Ailuropoda melanoleuca (giant panda): 100475516Help
Entry
100475516         CDS       T01329                                 

Definition
profilin-3-like
Orthology
K05759  
profilin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100475516
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100475516
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100475516
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100475516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 137 aa AA seqDB search
MGDWKGYISAVLRDQRIDDVAIVGYSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL
QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI
LNKTVHELIKGLRTQGT
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggggactggaaaggctatatcagtgcggtgctgcgagaccagcgcattgacgacgta
gccatcgtgggctactcagacaatcgctgcgtgtgggcatcgcgcccaggaggccttctg
gctgccatatcaccgcaagaggtgggtgtgctcacagggcctgatcggcgcaccttcctg
caggccggcctgagcgtggcaggccgccgctgctgcgtcatccgcgaccacttgctgtct
gagggcgatggagttctggacgcacgcactaaggggctggatgggcgtgcggtctgcgtg
ggccacaccccgcgcgtgctcctcgtgctcatgggccgacggggcgtgcacggcggcatc
ctcaacaagacagtgcatgaactgatcaaggggctgcgcacacagggcacctag

DBGET integrated database retrieval system