KEGG   Ailuropoda melanoleuca (giant panda): 100475738Help
Entry
100475738         CDS       T01329                                 

Gene name
GCK
Definition
glucokinase (hexokinase 4)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100475738 (GCK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100475738 (GCK)
   00052 Galactose metabolism
    100475738 (GCK)
   00500 Starch and sucrose metabolism
    100475738 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    100475738 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    100475738 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100475738 (GCK)
   04910 Insulin signaling pathway
    100475738 (GCK)
   04917 Prolactin signaling pathway
    100475738 (GCK)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100475738 (GCK)
   04950 Maturity onset diabetes of the young
    100475738 (GCK)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100475738 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 465 aa AA seqDB search
MLDDRARMEVTKKEKAEQILADFQLQEADLKKVMRRMQKEMARGLRLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVTTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRRCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRVVDENSLNPGQQLYEKLIGGKYMGE
LVRLVLLKLVDENLLFRGEASEQLRTRGAFETRFVSQVESDSGDRKQIYNILSTLGLRPS
ATDCDIVRRACESVSTRAAHMCAAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHASVRRLTPSCEITFIASEEGSGRGAALISAVACKKACMLGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgacagagccaggatggaggtcaccaagaaggaaaaggcggagcagatcctg
gcggacttccagctgcaggaggctgacctgaagaaggtgatgcggcggatgcagaaggag
atggcgcggggcctgcggctggagacccacgaggaggccagcgtgaagatgctgcccacc
tacgtccgctccaccccggagggctcagaagtcggggacttcctctccctggacctgggc
ggcaccaacttcagggtgatgctggtgaaggtgggggagggcgaggaggggcagtggagt
gtgacaaccaagcatcagatgtactccatccccgaggacgccatgactggcaccgctgag
atgctcttcgactacatctccgagtgcatctccgacttcctggacaagcaccagatgaag
cacaagaaactgcccttgggcttcaccttctccttccccgtgaggcatgaagacatcgac
aagggcatcctcctcaactggaccaagggcttcaaggcctcgggagcagaagggaacaac
atcgtggggctcctccgtgacgccatcaaacggagaggggactttgaaatggacgtggta
gcaatggtgaatgacacggtggccacgatgatctcctgctactacgaagaccgccggtgt
gaggttggcatgattgtgggcacgggctgtaacgcctgctacatggaggaaatgcagaac
gtggagctcgtggaaggggacgagggccgcatgtgcgtcaacactgagtggggcgccttt
ggggactctggagagctggacgagttcctgctggagtatgaccgcgtggtggacgagaac
tccctgaaccccggccagcagctgtacgagaagctcatcggcggcaagtacatgggcgag
ctggtgcggctcgtgctgttaaaactcgtggatgaaaacctgcttttccgcggggaggcc
tcggaacagctgcgcacgcgcggcgccttcgagacgcgcttcgtgtcgcaggtggagagt
gactcgggcgaccgcaagcagatctacaacatcctgagcacgctggggctgaggccctcg
gccaccgactgcgacatcgtgcgccgcgcctgcgagagcgtgtccacgcgcgctgcgcac
atgtgcgccgcggggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgaggac
gtgatgcgcatcaccgtgggcgtggacggctcggtgtacaagctgcaccccagcttcaag
gagaggttccacgccagcgtacgcaggctgacgcccagttgcgagatcacattcatcgcg
tcggaggagggcagtggccggggcgcggccctgatctccgcggtggcctgcaagaaggcc
tgcatgctgggccagtga

DBGET integrated database retrieval system