KEGG   Ailuropoda melanoleuca (giant panda): 100475857Help
Entry
100475857         CDS       T01329                                 

Gene name
FLNC
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100475857 (FLNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100475857 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100475857 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    100475857 (FLNC)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100475857 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2718 aa AA seqDB search
MMNNSGYSEAALGLGDEVDDMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL
QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN
FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPHGNTVLQPAHFTV
QTVDAGLGEVLVYIEDPEGHTEEAKVVPNNDKNRTYAVSYVPKVAGLHKVTVLFAGQNIE
RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIMDPQGR
RDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRAS
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV
VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLKTGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQP
AAPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLNLYAQDADGCPVNITVIP
NGDGTFRCSYVPTKPIKHTIIVSWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV
APPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG
AETQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP
APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI
PGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYKPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGIKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE
EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPSRVRAFGPGLEGGLVNKANHFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTAGDYDVNITFGGRPIPGSPFRVPVKDV
VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLHVAVLGPTGVAEPVEVLDNGGGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE
IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPMAH
GEEPSDMPQLRRPSTYPTHWATEEPVVPAEPMESMLRPFNLVIPFTVQKGELTGEVRMPS
GKTARPNITDNKDGTITVRYAPTEKGLHHMGIKYDGNHIPGSPLQFYVDAINSRHVSAYG
PGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDY
SIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSG
NEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRV
WGKGLSEGQTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPG
TYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQ
MVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFL
GRERLGSFGSITRQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGPHT
VTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGL
SIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDD
ARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHTIR
FIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFI
VNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSP
FKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQ
AFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILI
VKWGDESVPGSPFKVNVP
NT seq 8157 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggctactcggaggccgcgctcggcctgggcgacgaggtggacgac
atgccgtccacggagaaggacctcgcggaggacgcgccctggaagaagatccagcagaac
acgttcacgcgctggtgcaacgagcacctcaagtgcgtgggcaagcgcctgaccgacctg
cagcgcgacctcagcgacgggctgcgcctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagttccacccgcgccccaacttccgccagatgaagctggaaaacgtg
tccgtggccctcgagttcctcgagcgcgaacacatcaagctcgtgtccatcgacagcaag
gccatcgtggacgggaacctgaagctgatcctggggctcatctggacgctgatcctgcac
tattccatctccatgcccatgtgggaagatgaggatgacgaggacgcccgcaagcagacc
cccaaacagcgtctgctcggctggatccagaacaaggtgccgcagctgcccatcaccaac
ttcaaccgtgactggcaggacggcaaggctctgggcgccctagtggacaactgcgccccc
ggcctctgccctgactgggaggcctgggaccccaaccagcccgtggagaacgcccgggag
gccatgcagcaggcagacgactggcttggggtgccccaggtgattgcccccgaggagatt
gtggaccctaacgtggatgagcattctgtcatgacctacctgtcccagttccccaaggcc
aaactcaaacctggtgcccctgttcgctccaagcagctgaaccctaagaaggccatcgcc
tatgggcccggcatcgagccccatggcaacaccgtcctgcagcctgcccacttcaccgtg
cagacggtggacgccggcctgggcgaggtgctggtctacatcgaggaccctgagggccac
actgaggaggccaaggtggttcccaacaacgacaagaaccgcacctacgcggtctcctac
gttcctaaggtcgctgggctgcacaaggtgaccgtgctctttgctggccagaatatcgaa
cgcagccccttcgaggtgaacgtgggcatggccctgggggatgccaacaaggtgtcagcc
cgtggccctggcctggagcccgtgggcaatgtggccaacaaacccacctacttcgacatc
tacacggcgggggccgggactggtgatgttgctgtggtgatcatggacccgcagggccgg
cgggacacagtggaggtggccctggaggacaagggcgacagcacgttccgatgcacatac
aggcctgtgatggaggggccccacacggtgcacgtggccttcgctggtgcccccatcacc
cgcagtcctttccccgtccatgtggccgaagcctgtaaccccaacgcctgccgcgcctct
ggacggggcctgcagcccaagggtgtgcgcgtgaaagaggtggctgacttcaaggtgttc
actaagggtgccggcagtggggagctcaaggtcacagtcaaggggccaaagggcacagag
gagccggtgaaggtgcgggaggctggggacggtgtgttcgagtgtgagtactaccccgtg
gtacctgggaagtacgtggtgaccatcacatggggcggctacgccatcccccgcagcccc
tttgaggtacaggtgagcccagaggcaggagtacagaaggtccgggcctggggtcccggc
ctcaaaacgggccaggtgggcaagtcagccgactttgtggtggaggccatcggcacggag
gtggggacactgggcttctccattgaggggccctcgcaggccaagatcgagtgtgatgac
aagggggatggctcctgcgatgtgaggtactggcccacagagcccggggagtatgccgtg
catgtcatctgtgacgatgaggacatccgagactcgcccttcattgcccacatccaaccg
gctgcacctgactgcttcccagacaaggtgaaggccttcgggcccggcctggagcccact
ggctgcatcgtggacaagcctgctgagttcaccatcgatgctcgcgccgctggcaagggt
gacctgaatctgtatgcccaggatgctgatggctgccccgtcaacatcacagtcatcccc
aatggcgacggcaccttccgctgctcctacgtgcccaccaagcccattaaacacaccatc
atcgtctcctggggaggtgtcaacgtgcccaagagccccttccgggtaaatgtgggagaa
ggcagtcaccccgagcgggtgaaggtgtatggcccaggcgtggagaagacgggcctcaag
gccaacgagcctacctacttcacggtggactgcagcgaggccgggcaaggcgacgtgagt
attggcatcaagtgcgcccctggtgtcgtgggccctgcagaagctgacatcgactttgac
atcatcaagaatgacaatgacaccttcacagtcaagtacacacccccaggagccggccgc
tacaccattatggtgctgtttgccaaccaggagatccctgccagccccttccatattaag
gtggacccatcccacgatgccagcaaggtcaaggctgagggcccagggctgaaccgtaca
ggtgtggaagttgggaagcccactcacttcacggtgctgaccaagggagccggcaaggcc
aagctagacgtgcactttgcgggggccgccaagggcgaggctgtgcgggactttgaaatc
atcgacaaccacgactactcctacactgtcaagtacacggccgtccagcagggcaacatg
gcagtgacagtgacctatggtggggaccctgtccctaagagcccctttgtggtgaacgtg
gcgcccccgttggacctgagcaaagtcaaagttcaaggcctgaacagcaaggtggccgtg
gggcaagaacaggcattctctgtgaacacgcgtggggctggcggtcagggccagctggac
gtgcggatgacctcgccctcccgccgacccatcccctgtaagctggagcctgggggcggg
gccgaaacccaggctgtgcgctacatgccccccgaggagggaccctacaaggtggacatc
acctacgacggccacccagtgccgggcagcccctttgccgtggagggtgtcctgccccct
gacccctccaaggtctgtgcttacggccctggtctcaagggcggactggtgggcacccca
gcacccttctccattgacaccaaaggggctggcacaggcggcctggggctgaccgtggag
ggcccctgcgaggccaagatcgagtgccaggacaatggtgatggttcctgtgccgtcagc
tacctgcccaccgagccgggcgagtacaccatcaacatcctgtttgccgaagcgcacatc
cctggctcacccttcaaggccaccattcggcccgtgttcgacccgagcaaggtgcgggcc
agtgggccaggcctggagcgcggcaaggccggcgaggcagccaccttcaccgtggactgc
tcggaggcgggcgaggccgagctgaccattgagatcctgtcggacgccggcgtcaaggcc
gaggtcctgatccacaacaacgccgacggcacctaccacatcacctacaaacccgccttt
cccggcacctacaccattaccatcaagtatggcgggcaccccgtccccaaattccccacc
cgcgtccacgtgcagcctgccgtcgacactagtggaatcaaggtgtcggggcccggggtg
gagcctcatggtgtcctgcgggaggtgaccaccgagttcactgtggatgcgagatcccta
acagccacgggtgggaaccacgtgaccgcgcgtgtgctcaacccctcgggtgcaaagacg
gacacctacgtgacggataacggggacggcacctaccgagtgcagtacacagcctacgag
gagggcgtgcatctggtggaggtgctgtacgatgaggtagctgtgcccaagagccccttc
cgagtgggcgtgacggagggctgtgaccccagccgcgtgcgggcctttgggccaggcctg
gagggtggcttggtcaacaaggccaaccacttcaccgtggaaaccaggggagctggcact
ggaggcctaggcctagccattgagggcccctcggaagccaagatgtcctgtaaggacaac
aaagatggcagctgtaccgtggagtacatccccttcacagccggggactacgatgtcaac
atcacctttggggggcggcccatcccagggagcccgttccgggtgccggtgaaggatgtg
gtggaccctgggaaggtgaagtgctcagggccagggctgggggccggtgtcagggcccgg
gtgccccagaccttcacagtggactgcagccaagccggccgggccccgctgcacgtggcc
gtgctgggccccacaggtgtggccgagcccgtggaggtgctggacaacggaggtggcacc
cacactgtccactacaccccggccactgatgggccctacacggtagccgtcaagtacgcc
gaccaggaggtgccacgcagccccttcaagatcaaggtgcttcctgcccacgatgccagc
aaggtgcgggccagtggccccggcctcaacgcctctggcatccccgccagcttgcccgtg
gaattcaccattgatgcccgggatgctggtgagggtttgctcaccgtccagatcctggac
cccgagggaaagcccaagaaggccaacatccgagacaacggggatggcacatacaccgtg
tcttacctgccagacatgagtggccggtacaccatcaccatcaagtatggtggcgacgag
atcccctactcgcccttccgcatccatgccctgcccacgggggatgccagcaagtgtctt
gtcacagtgtccattggaggccatggcctgggtgcctgcctgggaccccgcatccagatc
ggggaggagactgtgatcacggtggatgccaaggcggcaggcaagggcaaggtgacatgc
acagtgtccacaccggatggggcagagctcgacgtggacgtggttgagaaccacgacggt
acctttgacatctactacacggcgcccgagccgggcaagtacgtcatcaccattcgcttt
ggaggcgagcacatccccaacagccccttccacgtgctggcgtgtgaccccatggcccac
ggggaggagccgtctgacatgccgcagctgcgccggcccagcacctaccccacgcactgg
gccacagaggagccagtggtgcctgcagagcccatggagtccatgctgaggcccttcaac
ctggtcatcccgttcaccgtgcagaaaggggaactcacaggggaggttcggatgccctcc
gggaagacggcccggcccaacatcaccgacaacaaggacggcaccatcacggtgaggtac
gcgcccactgagaaaggcctgcaccacatggggatcaagtacgacggcaaccacatcccc
ggaagccccctgcagttctatgtggacgccatcaatagccgccacgtcagtgcctatggg
ccaggcctgagccacggcatggtcaacaagccggccaccttcaccattgtcaccaaggac
gctggggaagggggtctgtccctggccgtggagggcccatccaaggccgagatcacctgc
aaggacaacaaggacggcacctgcaccgtgtcctacctgcccacagcgcccggagattac
agcatcatcgtgcgctttgatgacaagcacatcccggggagccccttcacagccaagatc
acaggcgatgactccatgcgcacgtcacagctgaacgtgggcacctccacggacgtgtca
ctgaagatcaccgagagtgacctaagcctgctgactgccagcatccgggcgccctcgggc
aatgaggagccctgcctgttaaagcgcctgcctaaccgccacattggcatctccttcacc
cccaaggaagttggggaacacgtggtaagtgtgcgcaagagtggcaagcacgtcaccaac
agccccttcaagatcctggtggggccatcggagatcggggacgccagcaaggtgcgcgtc
tggggcaaaggtctgtccgagggacaaaccttccaggtggcggagttcatcgtggacact
cgcaatgcaggttacgggggcctgggactgagtatcgaaggccctagcaaggtggacatc
aactgtgaggacatggaggacggtacgtgcaaagtcacctactgccccactgagcccggc
acctacatcatcaacatcaaatttgctgacaagcacgtgcccggaagccccttcaccgtg
aaggtgacaggcgaaggccgcatgaaggaaagcatcacccggcgcagacaggcgccttcc
atcgccaccatcggcagcacctgtgacctcaacctcaagatcccagggaactggttccag
atggtgtccgcccaggagcgcctgacgcggaccttcacccgcagcagccacacgtacacc
cgcacggaacgcacggagatcagcaagacgcggggcggggagaccaagcgcgaggtgcgg
gtggaggagtccacccaggtcggtggagacccctttcccgccgtcttcggggacttcctg
ggccgggagcggctgggctccttcggcagcatcacccggcaggagggtgaggccagttct
caggacatgaccgcacaggtgaccagcccatcgggcaagatggaagccgcagagattgtc
gagggagaagacagtgcgtacagcgtgcgtttcgtgccccaggagatggggccccacaca
gtcactgtcaagtaccgcggccagcatgtacctggcagcccctttcagttcactgtgggg
ccactgggagaaggcggagcccacaaagtgagggctggaggcacaggactcgagcgaggg
gtggccggcgtgccagccgagttcagcatttggacccgagaagcaggtgctgggggcctg
tccattgctgtggagggtcccagcaaggcggagatcgcgtttgaggacagaaaagatggc
tcctgtggggtctcctatgttgtccaggaaccaggtgactatgaggtctccatcaagttc
aacgacgagcacataccagacagcccctttgtggttcctgtggcttctctctccgatgat
gctcgccgcctcaccgtcaccagcctccaggagacggggctcaaggtgaaccagccggcg
tcctttgcggtgcagctgaatggtgctcggggcgtgatcgatgcacgtgtgcacacgccc
tcgggcgccgtggaggagtgctacgtctccgagctggacagcgacaagcacaccatccgc
ttcatcccccatgagaacggcgtccactctattgatgtcaagttcaacggtgcccacatc
cctggcagtcccttcaagatccgcgttggggagcagagccaggctggggacccaggcttg
gtgtcagcttatggtcctgggcttgaggggggcactactggcgtgtcatcagagttcatc
gtcaacaccctgaacgcgggctcaggggccttgtctgtcaccatcgacggcccctccaag
gtacagctggactgtcgggagtgtccggagggccatgtggtcacttacactcccatggcc
cctggcaactacctcattgctatcaagtacggtggcccccagcacatcgtgggcagtccc
ttcaaggccaaagtcacaggtccccggctgtctggaggccacagccttcacgaaacttcc
acggttctggtggagaccgtgaccaagtcatcctccagccgtggctccagctacagctcc
atccctaagttctcctcagatgccagcaaggtggtgacacggggtccggggctgtcccag
gcctttgtgggccagaagaactccttcactgtggactgcagcaaagcaggcaccaacatg
atgatggtgggcgtgcacgggcccaagaccccctgtgaggaggtctacgtgaagcacatg
gggaaccgggtatacaacgtcacctacaccgtcaaggagaaaggggactacattctcatc
gtcaagtggggcgacgaaagtgtccccggaagccctttcaaagtcaacgtgccctga

DBGET integrated database retrieval system