KEGG   Ailuropoda melanoleuca (giant panda): 100475867Help
Entry
100475867         CDS       T01329                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00010  Glycolysis / Gluconeogenesis
aml00052  Galactose metabolism
aml00500  Starch and sucrose metabolism
aml01100  Metabolic pathways
aml04068  FoxO signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100475867 (G6PC2)
   00052 Galactose metabolism
    100475867 (G6PC2)
   00500 Starch and sucrose metabolism
    100475867 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100475867 (G6PC2)
   04151 PI3K-Akt signaling pathway
    100475867 (G6PC2)
   04152 AMPK signaling pathway
    100475867 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100475867 (G6PC2)
   04922 Glucagon signaling pathway
    100475867 (G6PC2)
   04920 Adipocytokine signaling pathway
    100475867 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100475867 (G6PC2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100475867 (G6PC2)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100475867 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 100475867
NCBI-ProteinID: XP_002916563
Ensembl: ENSAMEG00000010863
Position
Un
AA seq 356 aa AA seqDB search
MDFLHRNGVLAIQHLQKDYRAYYNFLNFMSNVGDPRNIFSIYFPLWFQLNQTIGTKMIWV
AVIGDWFNLIFKWLLFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSHTVSRMDKSLTIYLHRLTWSFLWSLFWLIQISVCISRVFIATHFPHQV
ILGVFGGMLVAEAFEHTPGIQTASLSTYLKTNLFLFLFALGFYLLLRLFDIDLLWSVPIA
KKWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLRSCRGENGYKLSFRLLCAVT
SLITLQLYHFIKIPTHAEHLFYILSFCKSASIPLTVVALIPYCIHMLMKPSEKKIN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcataggaatggagtgctcgctattcagcatttgcagaaggactatcga
gcttactacaattttctaaattttatgtccaatgttggtgatccccggaatatcttttct
atttattttccactttggtttcaacttaatcagacaattggaaccaagatgatatgggta
gcagtcattggggattggttcaatcttatttttaaatggttattgtttggtcatcggcct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccccactacatgtgaaacaggtccaggaagtccatcgggccatgcaatgggctcatcg
tgtgtctggtatgtcatggtaacagctgccctgagccacactgtcagtcggatggataag
tcgttgaccatttatctgcacagactgacctggtcatttctttggagtcttttttggttg
attcaaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagtt
attcttggagtatttggtggcatgcttgtggcagaggcctttgaacacactccaggcatc
cagacagcgagcttgagcacgtatctgaagaccaacctcttcctctttctgtttgcactc
ggcttttacctgctcctcagactgtttgacattgacctgctgtggtctgtgcccatagct
aagaaatggtgcgccaaccctgactggatccacattgataccacgccttttgccggactc
gtgaggaatcttggggtgctctttggcttgggctttgcaatcaactcagagatgttcctt
aggagctgccggggggaaaatggctacaagctgagcttccggctgctctgtgcagtgacc
tcgttgatcacactgcagctctaccatttcatcaagatccccactcatgcagaacattta
ttttacatcctgtctttctgtaaaagtgcatccattccactgaccgtggtcgctctgatt
ccctactgtattcatatgttaatgaaaccaagtgaaaagaagattaattag

DBGET integrated database retrieval system