KEGG   Ailuropoda melanoleuca (giant panda): 100475919Help
Entry
100475919         CDS       T01329                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04620  Toll-like receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04912  GnRH signaling pathway
aml04926  Relaxin signaling pathway
aml05142  Chagas disease (American trypanosomiasis)
aml05161  Hepatitis B
aml05164  Influenza A
aml05166  HTLV-I infection
aml05167  Kaposi's sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05418  Fluid shear stress and atherosclerosis
Module
aml_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100475919 (MAP2K4)
   04012 ErbB signaling pathway
    100475919 (MAP2K4)
   04668 TNF signaling pathway
    100475919 (MAP2K4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100475919 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100475919 (MAP2K4)
  Endocrine system
   04912 GnRH signaling pathway
    100475919 (MAP2K4)
   04926 Relaxin signaling pathway
    100475919 (MAP2K4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100475919 (MAP2K4)
  Infectious diseases
   05166 HTLV-I infection
    100475919 (MAP2K4)
   05164 Influenza A
    100475919 (MAP2K4)
   05161 Hepatitis B
    100475919 (MAP2K4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100475919 (MAP2K4)
   05169 Epstein-Barr virus infection
    100475919 (MAP2K4)
   05142 Chagas disease (American trypanosomiasis)
    100475919 (MAP2K4)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100475919 (MAP2K4)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: STE group
  STE7 family
   100475919 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100475919
NCBI-ProteinID: XP_019665195
Ensembl: ENSAMEG00000013165
Position
Un
AA seq 349 aa AA seqDB search
MTLYVQGAADQDEKGESGNKSQVFSVIRTLKCITSDHCRTGKRKALKLNFANPPFKSTAR
FTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNK
MVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICM
ELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLD
RSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLY
ELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLW
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactttgtatgtccagggagcagctgaccaagatgagaaaggagagtcggggaacaag
tcacaggtcttctcagtgataaggactctgaaatgcataacctcagaccattgtcgcact
ggtaaacgcaaagcactgaagttgaattttgcaaatccacctttcaaatctaccgcaagg
tttactctgaatcccaaccctacaggagttcaaaacccacacatagagagactgagaaca
cacagcattgaatcgtcaggaaaactgaagatctcccctgagcaacactgggatttcact
gcggaggacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaa
atggtccacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggat
gaaaaagaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgc
ccgtacattgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatg
gaactcatgtctacctcgtttgataagttttacaaatatgtatatagtgtattagacgat
gttattccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccac
ttaaaagaaaacttgaaaatcattcacagagatatcaaaccttccaatattcttctggac
aggagtggaaatattaagctctgtgactttggcatcagtggacagctggtggactccatt
gccaagacaagagatgccgggtgtaggccatacatggcacctgaaagaatagacccgagt
gcgtcgcgacaaggatatgacgtccgctctgatgtctggagtttggggatcacattgtac
gagttagccacaggccggtttccttatccaaagtggaatagtgtatttgatcaactcaca
caagtcgtcaaaggggaccctccacagctgagtaactctgaagaaagggagttctccccg
agcttcatcaactttgtcaacttgtggtga

DBGET integrated database retrieval system