KEGG   Ailuropoda melanoleuca (giant panda): 100475975Help
Entry
100475975         CDS       T01329                                 

Definition
dual specificity mitogen-activated protein kinase kinase 7-like
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aml04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:aml04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:aml04012]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:aml04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:aml04620]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:aml04660]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:aml04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:aml04912]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:aml04722]
Organismal Systems; Development; Osteoclast differentiation [PATH:aml04380]
Human Diseases; Infectious diseases; Influenza A [PATH:aml05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:aml05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 400 aa AA seqDB search
MDETGLVIVITLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPARPRNMLGLPS
TLYMPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRF
RKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELM
GTCAEKLKKRVQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKL
CDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQ
FPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSF
IKRYEMLEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatgagacagggcttgttattgtgatcactctaagccctgctcctgccccgtcccaa
cgagcagccctccagctccctctggccaatgatgggggcagccgctcaccgtcctccgag
agctccccacagcaccccacaccccctgcccggccccgaaacatgctggggcttccgtca
accttgtatatgccccgcagcatggagagcattgagattgaccagaagctgcaggagatc
atgaagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaacgat
ctggagaacctgggggagatgggcagcggcacgtgcggccaggtgtggaagatgcgcttc
aggaagacgggccacgtcatcgccgtcaagcaaatgcggcgctccgggaataaggaggag
aacaagcggatcctcatggacctggacgtggtactcaagagccatgactgcccctacatc
gtgcagtgtttcggcaccttcatcaccaacacggatgtcttcatcgccatggagctcatg
ggcacgtgtgccgagaagctcaagaagcgggtgcagggccccatccccgagcggatcctg
ggcaagatgacggtggcgatcgtgaaggctctgtactacctgaaggagaagcacggcgtg
atccaccgtgacgtcaagccctcgaacatcctgctggacgagcggggccagatcaagctc
tgtgacttcggcatcagcggccgtctcgtcgattccaaggccaagacacgcagcgccggc
tgtgccgcctacatggccccggagcgcatagaccctccggaccccaccaagccagactac
gacatccgggccgatgtgtggagcctgggcatctccttggtggagctggcgacgggacag
tttccctacaagaattgcaagacagactttgaggtccttaccaaagtcctgcaggaagag
cccccgctcttgcccggccacatgggcttctcaggggactttcagtccttcgtcaaagac
tgccttactaaggatcacaggaagagaccaaagtataataagctacttgaacacagcttc
atcaagcgctacgagatgctggaggtagacgtggcgtcctggttcaaggacgtcatggcg
aagactgagtcaccgaggactagcggagtcctgagccagcaccacctgcccttcttcagg
tag

DBGET integrated database retrieval system