KEGG   Ailuropoda melanoleuca (giant panda): 100475975Help
Entry
100475975         CDS       T01329                                 

Gene name
MAP2K7
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100475975 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100475975 (MAP2K7)
   04012 ErbB signaling pathway
    100475975 (MAP2K7)
   04668 TNF signaling pathway
    100475975 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100475975 (MAP2K7)
   04660 T cell receptor signaling pathway
    100475975 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    100475975 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    100475975 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    100475975 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    100475975 (MAP2K7)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100475975 (MAP2K7)
   05169 Epstein-Barr virus infection
    100475975 (MAP2K7)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100475975 (MAP2K7)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100475975 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 380 aa AA seqDB search
MPPLQLPLANDGGSRSPSSESSPQHPTPPARPRNMLGLPSTLYMPRSMESIEIDQKLQEI
MKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEE
NKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRVQGPIPERIL
GKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAG
CAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEE
PPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYEMLEVDVASWFKDVMA
KTESPRTSGVLSQHHLPFFR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccccccctccagctccctctggccaatgatgggggcagccgctcaccgtcctccgag
agctccccacagcaccccacaccccctgcccggccccgaaacatgctggggcttccgtca
accttgtatatgccccgcagcatggagagcattgagattgaccagaagctgcaggagatc
atgaagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaacgat
ctggagaacctgggggagatgggcagcggcacgtgcggccaggtgtggaagatgcgcttc
aggaagacgggccacgtcatcgccgtcaagcaaatgcggcgctccgggaataaggaggag
aacaagcggatcctcatggacctggacgtggtactcaagagccatgactgcccctacatc
gtgcagtgtttcggcaccttcatcaccaacacggatgtcttcatcgccatggagctcatg
ggcacgtgtgccgagaagctcaagaagcgggtgcagggccccatccccgagcggatcctg
ggcaagatgacggtggcgatcgtgaaggctctgtactacctgaaggagaagcacggcgtg
atccaccgtgacgtcaagccctcgaacatcctgctggacgagcggggccagatcaagctc
tgtgacttcggcatcagcggccgtctcgtcgattccaaggccaagacacgcagcgccggc
tgtgccgcctacatggccccggagcgcatagaccctccggaccccaccaagccagactac
gacatccgggccgatgtgtggagcctgggcatctccttggtggagctggcgacgggacag
tttccctacaagaattgcaagacagactttgaggtccttaccaaagtcctgcaggaagag
cccccgctcttgcccggccacatgggcttctcaggggactttcagtccttcgtcaaagac
tgccttactaaggatcacaggaagagaccaaagtataataagctacttgaacacagcttc
atcaagcgctacgagatgctggaggtagacgtggcgtcctggttcaaggacgtcatggcg
aagactgagtcaccgaggactagcggagtcctgagccagcaccacctgcccttcttcagg
tag

DBGET integrated database retrieval system