KEGG   Ailuropoda melanoleuca (giant panda): 100476006Help
Entry
100476006         CDS       T01329                                 

Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100476006
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100476006
   04114 Oocyte meiosis
    100476006
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100476006
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100476006
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100476006
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100476006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 825 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSNCL
PSSCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcagttttccttgcagaacgactgtatgctgaagtacactcagaggaagcc
ttgtttttattggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcagtgtaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtctttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgttttactctctcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacatctttacagaactttagcaactgtctg
cccagctcgtgcacaacactagtatctaatcatagtttatcgcacagacagcctgagact
gttcttacagaaacaccccaggacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatt
tcaccagatactgtccctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagcttattaggaggaccagctgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccatctactggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcacagagtggaaatagtcga
gaggtaaccccaattcttgttgcacaaacacaaagttctggtccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcactgcctcgaagaagttca
cgactttttactagtgacagctctacgaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatcccaaacagaaaaactaaaagtaaaactaataaagggggaataact
caacctaacataaatgatagcctggaaattacaaaattggactcttccatcatttcagaa
gggaaaatctccacaatcacacctcagatccaggcatttaatctacagaaagcagcagca
gaaggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcatac
aactgcaaagaagctataaatatcttgagccacctaccttctcaccactacaatactggt
tgggtactgtgccaaattggaagggcctattttgaactttcagagtatatgcaagctgaa
agaatattctcagaggttagaaggattgagaattacagagttgaaggcatggagatctac
tctacaacactgtggcatcttcaaaaagatgttgctctttcagttctttcaaaagactta
acagacatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagtttg
caacgggaacatgatattgcaattaaattcttccagagagctatccaggttgatccaaat
tatgcgtatgcctatactctattagggcatgagtttgtattaactgaagaattagacaaa
gcattagcttgttttcgaaatgctatcagagtcaatccgagacattataatgcatggtat
ggtttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccag
aaagcacttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcag
catgcactgaaaaaatctgagaaggctttggataccctaaacaaagccattgtcattgat
cccaagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatat
aagtctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtt
tacttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaatt
gataaacgctaccttccagatgatgaggagccaataacccaagaagaacagatcatggga
acagatgaatcccaggagagcagcatgacagatgcagacgacacacagcttcatgcagct
gaaagtgatgaattttaa

DBGET integrated database retrieval system