KEGG   Ailuropoda melanoleuca (giant panda): 100476006Help
Entry
100476006         CDS       T01329                                 

Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:aml04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:aml04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:aml04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:aml04914]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:aml05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 825 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSNCL
PSSCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcagttttccttgcagaacgactgtatgctgaagtacactcagaggaagcc
ttgtttttattggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcagtgtaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtctttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgttttactctctcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacatctttacagaactttagcaactgtctg
cccagctcgtgcacaacactagtatctaatcatagtttatcgcacagacagcctgagact
gttcttacagaaacaccccaggacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatt
tcaccagatactgtccctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagcttattaggaggaccagctgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccatctactggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcacagagtggaaatagtcga
gaggtaaccccaattcttgttgcacaaacacaaagttctggtccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcactgcctcgaagaagttca
cgactttttactagtgacagctctacgaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatcccaaacagaaaaactaaaagtaaaactaataaagggggaataact
caacctaacataaatgatagcctggaaattacaaaattggactcttccatcatttcagaa
gggaaaatctccacaatcacacctcagatccaggcatttaatctacagaaagcagcagca
gaaggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcatac
aactgcaaagaagctataaatatcttgagccacctaccttctcaccactacaatactggt
tgggtactgtgccaaattggaagggcctattttgaactttcagagtatatgcaagctgaa
agaatattctcagaggttagaaggattgagaattacagagttgaaggcatggagatctac
tctacaacactgtggcatcttcaaaaagatgttgctctttcagttctttcaaaagactta
acagacatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagtttg
caacgggaacatgatattgcaattaaattcttccagagagctatccaggttgatccaaat
tatgcgtatgcctatactctattagggcatgagtttgtattaactgaagaattagacaaa
gcattagcttgttttcgaaatgctatcagagtcaatccgagacattataatgcatggtat
ggtttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccag
aaagcacttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcag
catgcactgaaaaaatctgagaaggctttggataccctaaacaaagccattgtcattgat
cccaagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatat
aagtctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtt
tacttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaatt
gataaacgctaccttccagatgatgaggagccaataacccaagaagaacagatcatggga
acagatgaatcccaggagagcagcatgacagatgcagacgacacacagcttcatgcagct
gaaagtgatgaattttaa

DBGET integrated database retrieval system