KEGG   Ailuropoda melanoleuca (giant panda): 100476035Help
Entry
100476035         CDS       T01329                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00562  Inositol phosphate metabolism
aml01100  Metabolic pathways
aml04020  Calcium signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04919  Thyroid hormone signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
Module
aml_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100476035 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100476035 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100476035 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100476035 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100476035 (PLCD1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100476035 (PLCD1)
Membrane trafficking [BR:aml04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100476035 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100476035 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 SPARC_Ca_bdg TEP1_N
Motif
Other DBs
NCBI-GeneID: 100476035
NCBI-ProteinID: XP_002914681
Ensembl: ENSAMEG00000017808
Position
Un
AA seq 765 aa AA seqDB search
MDSGRDFLTLHGLQDDEDLQVLLKGSQLLKVKSNSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRKGHRTEGMEKFARDVPEDRCFSIVFKDQRNTLDLISPSPAEAQH
WVQGLRKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDRSQTDSLEDDEIEAFYKMLTQREEIDRTFTQAAGSRETLSVDQLVTFLQHQ
QREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMSQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIEGLAATPTRRALCKGCRCLELDCWDGPNQE
PIIYHGYTFTSKILLCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRTILGP
MLLDRPLDGVTASLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDE
AVRSRVQRKPREDKLRLVEELSDMVIYCKSVHFGGFSSSGTPGQAFYEMASFSENRALRL
LQESGNSFVRHNVSHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQG
RFQDNGACGYVLKPAFLRDPNSTFNSRALAQGPWWTRKRLSVRVISGQQLPKVNKNKNSI
VDPKVTVEIHGVGQDVASRQTAVVTNNGFNPWWDTEFEFEVVVPELALVRFVVEDYDASS
KNDFIGQSTIPLGSLKQGYRHVHLLSKNGDQHPSATLFVKVYLQD
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcatggtctacaggatgacgaggacctacag
gtactgctaaagggcagccagctcctgaaggtgaagtccaactcatggcggagagagcgt
ttctacaaactgcaggaagactgcaagaccatctggcaggagtcccgcaaggtcatgcgg
accccggagtcccagctgttctccattgaggacattcaggaggtgcggaagggccaccgc
acggagggcatggagaagtttgcccgggatgtgcctgaggaccgctgcttctccatcgtc
ttcaaggaccagcgcaacacgctagacctcatctccccgtcgccggcggaggcccagcac
tgggtgcagggcctgcgcaagatcatccaccactcgggctccatggaccagaggcagaag
ctgcagcactggattcactcctgcttgcgaaaagctgacaaaaataaggacaacaagatg
agcttcaaggagctgcagaacttcctaaaggagctcaacatccaggtggatgatagctac
gcccggaagatcttcagggagtgtgaccgctcccagacggactctctggaggatgatgag
atcgaggccttctacaagatgctgacccagcgggaggagattgaccgcaccttcacccag
gcggccggctccagggaaacgctgtcggtggaccagttagtgacgttcctgcagcaccag
caacgggaggaggctgcagggccagcactggccctctccctcattgagcgctacgagccc
agtgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacctgctg
tccgccgacggcagcgccttcagcctggcgcaccggcgggtgtaccaggacatgagccag
ccgctcagccactacctggtgtcctcctcgcacaacacctacctgctggaagaccagctc
acggggcccagcagcaccgaagcctacatcgagggcctagccgccacgcctacccgcagg
gcgttgtgcaaaggctgccgctgcctggagctggactgctgggacggccccaaccaggag
ccgatcatctaccacggctacactttcacgtccaagatcctcctctgcgacgtgctcagg
gccatccgggactacgccttcaaggcgtccccctaccccgtcatcctgtccctggagaac
cactgcagcctggagcaacagcgtgtgatggcgcgacacctgcgcaccatcctgggcccc
atgctgttggaccggccgctggatggggtcaccgcaagtctgccttcccctgagcaactg
aaggggaagatcttgctgaaggggaagaagcttggggggctcctgccccctggcggggag
ggtggccctgaagccactgttgtgtccgatgaggatgaggctgctgagatggaggacgag
gcagtgaggagccgcgtgcagcgcaagcccagggaggacaagctcaggctagtggaggag
ctctccgatatggtcatttactgcaagagtgtccacttcgggggcttctccagctctggc
accccagggcaggctttctatgagatggcgtccttctctgagaaccgcgccctccgactg
ctccaagaatcaggaaacagctttgtccgccacaacgtcagtcacctgagcaggatttac
cccgctgggtggaggacagactcctccaactacagccctgtggagatgtggaacgggggc
tgccagatcgtggccctgaatttccagacacctggcccagagatggacgtgtaccagggc
cgcttccaggacaacggggcctgtgggtatgtgctgaagcctgccttcctgcgagaccca
aactctacctttaactcacgtgccctggctcaggggccctggtggacccggaagcgactc
agtgtcagggtcatctccgggcagcagttgccaaaagtcaataagaataagaattcaatt
gtggaccccaaggtgaccgtggagatccatggtgtgggccaggacgtggccagccgccag
actgccgtggtcaccaataacggtttcaacccatggtgggacacagagtttgagtttgag
gtggtggtgcctgagcttgccctcgtgcgcttcgtggtggaggattatgacgcatcctct
aagaacgacttcattggccagagcaccatccccttgggcagcctcaagcaaggataccgc
catgtccacctcttatcaaagaacggagaccagcacccatccgccaccctctttgtgaag
gtgtatctccaggactag

DBGET integrated database retrieval system