KEGG   Ailuropoda melanoleuca (giant panda): 100476035Help
Entry
100476035         CDS       T01329                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100476035
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100476035
   04070 Phosphatidylinositol signaling system
    100476035
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100476035
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100476035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 765 aa AA seqDB search
MDSGRDFLTLHGLQDDEDLQVLLKGSQLLKVKSNSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRKGHRTEGMEKFARDVPEDRCFSIVFKDQRNTLDLISPSPAEAQH
WVQGLRKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDRSQTDSLEDDEIEAFYKMLTQREEIDRTFTQAAGSRETLSVDQLVTFLQHQ
QREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMSQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIEGLAATPTRRALCKGCRCLELDCWDGPNQE
PIIYHGYTFTSKILLCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRTILGP
MLLDRPLDGVTASLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDE
AVRSRVQRKPREDKLRLVEELSDMVIYCKSVHFGGFSSSGTPGQAFYEMASFSENRALRL
LQESGNSFVRHNVSHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQG
RFQDNGACGYVLKPAFLRDPNSTFNSRALAQGPWWTRKRLSVRVISGQQLPKVNKNKNSI
VDPKVTVEIHGVGQDVASRQTAVVTNNGFNPWWDTEFEFEVVVPELALVRFVVEDYDASS
KNDFIGQSTIPLGSLKQGYRHVHLLSKNGDQHPSATLFVKVYLQD
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcatggtctacaggatgacgaggacctacag
gtactgctaaagggcagccagctcctgaaggtgaagtccaactcatggcggagagagcgt
ttctacaaactgcaggaagactgcaagaccatctggcaggagtcccgcaaggtcatgcgg
accccggagtcccagctgttctccattgaggacattcaggaggtgcggaagggccaccgc
acggagggcatggagaagtttgcccgggatgtgcctgaggaccgctgcttctccatcgtc
ttcaaggaccagcgcaacacgctagacctcatctccccgtcgccggcggaggcccagcac
tgggtgcagggcctgcgcaagatcatccaccactcgggctccatggaccagaggcagaag
ctgcagcactggattcactcctgcttgcgaaaagctgacaaaaataaggacaacaagatg
agcttcaaggagctgcagaacttcctaaaggagctcaacatccaggtggatgatagctac
gcccggaagatcttcagggagtgtgaccgctcccagacggactctctggaggatgatgag
atcgaggccttctacaagatgctgacccagcgggaggagattgaccgcaccttcacccag
gcggccggctccagggaaacgctgtcggtggaccagttagtgacgttcctgcagcaccag
caacgggaggaggctgcagggccagcactggccctctccctcattgagcgctacgagccc
agtgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacctgctg
tccgccgacggcagcgccttcagcctggcgcaccggcgggtgtaccaggacatgagccag
ccgctcagccactacctggtgtcctcctcgcacaacacctacctgctggaagaccagctc
acggggcccagcagcaccgaagcctacatcgagggcctagccgccacgcctacccgcagg
gcgttgtgcaaaggctgccgctgcctggagctggactgctgggacggccccaaccaggag
ccgatcatctaccacggctacactttcacgtccaagatcctcctctgcgacgtgctcagg
gccatccgggactacgccttcaaggcgtccccctaccccgtcatcctgtccctggagaac
cactgcagcctggagcaacagcgtgtgatggcgcgacacctgcgcaccatcctgggcccc
atgctgttggaccggccgctggatggggtcaccgcaagtctgccttcccctgagcaactg
aaggggaagatcttgctgaaggggaagaagcttggggggctcctgccccctggcggggag
ggtggccctgaagccactgttgtgtccgatgaggatgaggctgctgagatggaggacgag
gcagtgaggagccgcgtgcagcgcaagcccagggaggacaagctcaggctagtggaggag
ctctccgatatggtcatttactgcaagagtgtccacttcgggggcttctccagctctggc
accccagggcaggctttctatgagatggcgtccttctctgagaaccgcgccctccgactg
ctccaagaatcaggaaacagctttgtccgccacaacgtcagtcacctgagcaggatttac
cccgctgggtggaggacagactcctccaactacagccctgtggagatgtggaacgggggc
tgccagatcgtggccctgaatttccagacacctggcccagagatggacgtgtaccagggc
cgcttccaggacaacggggcctgtgggtatgtgctgaagcctgccttcctgcgagaccca
aactctacctttaactcacgtgccctggctcaggggccctggtggacccggaagcgactc
agtgtcagggtcatctccgggcagcagttgccaaaagtcaataagaataagaattcaatt
gtggaccccaaggtgaccgtggagatccatggtgtgggccaggacgtggccagccgccag
actgccgtggtcaccaataacggtttcaacccatggtgggacacagagtttgagtttgag
gtggtggtgcctgagcttgccctcgtgcgcttcgtggtggaggattatgacgcatcctct
aagaacgacttcattggccagagcaccatccccttgggcagcctcaagcaaggataccgc
catgtccacctcttatcaaagaacggagaccagcacccatccgccaccctctttgtgaag
gtgtatctccaggactag

DBGET integrated database retrieval system