KEGG   Ailuropoda melanoleuca (giant panda): 100476058Help
Entry
100476058         CDS       T01329                                 

Definition
ubiquitin carboxyl-terminal hydrolase 46-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 359 aa AA seqDB search
MNCFQGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYK
AQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLNY
LLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCET
VSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKL
PMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVAVVVHCGS
GPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtttccagggcaccaatgcctctgctctggaaaaagacattggtccagagcag
tttccaatcaatgaacactactttggattggtcaacttcggaaatacgtgctactgtaac
tctgtgcttcaggccttgtacttctgccggccgttccgggagaatgtgctggcatacaag
gcccagcaaaaaaagaaggaaaacttactgacgtgcctggcagacctcttccacagcatc
gccacgcagaagaagaaggttggcgtgatcccaccaaagaagttcatttcgcggctgaga
aaagagaacgatctctttgataactacatgcagcaggatgctcacgagtttttaaattat
ttgctaaacactattgcggacatcctgcaggaagagaagaaacaggaaaaacaaaacgga
aaattaaaaaatggcaacatgaatgaacctgcagagaataacaaaccagaactcacctgg
gtccatgagatttttcagggaacgctgaccaatgaaactcgatgcttgaactgtgaaact
gttagtagcaaagatgaagattttcttgacctttctgtcgatgtggagcagaatacatct
attacccactgtctgagagacttcagcaacacagaaacactgtgtagtgaacagaaatat
tattgtgaaacatgctgcagcaaacaggaggcccagaaaaggatgagagtgaaaaagctg
cccatgatcttggccctgcacctgaagcggttcaagtacatggagcagctgcacagatac
accaagctgtcttaccgggtggtcttcccgctggagctgcggctcttcaacacgtccagc
gacgccgtgaacctggaccgcatgtacgacctggtggccgtggtggtgcactgcggcagt
ggccctaaccgcggccattatatcactatcgtgaagagtcacggtttctggcttttgttc
gatgacgacatcgtagagaaaatagatgcccaagctattgaagaattctatggcctgaca
tcagatatatcaaaaaattcagaatctggatatattttattctatcagtcaagagagtaa

DBGET integrated database retrieval system